SitesBLAST
Comparing BPHYT_RS22250 FitnessBrowser__BFirm:BPHYT_RS22250 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
28% identity, 56% coverage: 165:395/414 of query aligns to 116:348/369 of S5FMM4
- S202 (≠ L248) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ L379) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (≠ I389) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
Sites not aligning to the query:
- 51 G→S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- 54 A→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
- 81 K→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
4yshA Crystal structure of glycine oxidase from geobacillus kaustophilus
29% identity, 57% coverage: 176:409/414 of query aligns to 131:367/370 of 4yshA
- active site: I262 (≠ T307), L283 (≠ T332), G305 (= G347), N335 (≠ H377), L338 (≠ T380)
- binding flavin-adenine dinucleotide: V178 (≠ A223), S206 (≠ L248), G207 (= G249), W209 (= W251), R307 (= R349), H332 (= H374), R334 (≠ H376), N335 (≠ H377), G336 (= G378), I337 (≠ L379)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 47, 48
4yshB Crystal structure of glycine oxidase from geobacillus kaustophilus
29% identity, 57% coverage: 176:409/414 of query aligns to 131:367/368 of 4yshB
- active site: I262 (≠ T307), L283 (≠ T332), G305 (= G347), N335 (≠ H377), L338 (≠ T380)
- binding flavin-adenine dinucleotide: V178 (≠ A223), S206 (≠ L248), W209 (= W251), R307 (= R349), H332 (= H374), R334 (≠ H376), N335 (≠ H377), G336 (= G378), I337 (≠ L379), L338 (≠ T380)
- binding glycine: G249 (= G293), Y251 (≠ L295), Y251 (≠ L295), A264 (= A309), R307 (= R349), R334 (≠ H376), R334 (≠ H376)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 9, 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 48
Q5L2C2 Glycine oxidase; GO; GOX; GOXK; EC 1.4.3.19 from Geobacillus kaustophilus (strain HTA426)
31% identity, 45% coverage: 222:409/414 of query aligns to 182:369/377 of Q5L2C2
- R309 (= R349) binding
- 334:340 (vs. 374:380, 29% identical) binding
- R336 (≠ H376) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 180 binding
5i39A High resolution structure of l-amino acid deaminase from proteus vulgaris with the deletion of the specific insertion sequence (see paper)
28% identity, 53% coverage: 193:410/414 of query aligns to 165:383/383 of 5i39A
- active site: Q248 (≠ G270), P267 (≠ E291)
- binding flavin-adenine dinucleotide: A196 (vs. gap), A197 (vs. gap), G226 (≠ L248), G227 (= G249), W229 (= W251), Q248 (≠ G270), Q250 (≠ H272), G321 (= G347), M323 (≠ R349), T348 (≠ H374), G349 (≠ A375), W350 (≠ H376), G351 (= G378), M352 (≠ L379), T353 (= T380)
Sites not aligning to the query:
- active site: 66, 69, 70
- binding flavin-adenine dinucleotide: 30, 31, 33, 34, 35, 53, 54, 55, 62, 63, 66, 67, 69
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
26% identity, 58% coverage: 162:401/414 of query aligns to 96:354/364 of 3if9A
- binding flavin-adenine dinucleotide: P173 (vs. gap), V174 (vs. gap), S202 (≠ L248), G203 (= G249), W205 (= W251), F209 (≠ A255), G300 (= G347), R302 (= R349), H327 (= H374), F328 (≠ A375), R329 (≠ H376), N330 (≠ H377), G331 (= G378), I332 (≠ L379)
- binding glycolic acid: Y246 (≠ L295), R302 (= R349), R329 (≠ H376)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 34, 35, 42, 43, 46, 47, 48, 49
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
25% identity, 58% coverage: 162:401/414 of query aligns to 96:354/369 of O31616
- V174 (vs. gap) binding
- H244 (vs. gap) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (= R349) binding
- 327:333 (vs. 374:380, 29% identical) binding
- R329 (≠ H376) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 51 G→R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; G→S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- 54 A→R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
25% identity, 58% coverage: 162:401/414 of query aligns to 96:354/364 of 1ng3A
- binding acetylamino-acetic acid: Y246 (≠ L295), R302 (= R349), R329 (≠ H376)
- binding flavin-adenine dinucleotide: V174 (vs. gap), S202 (≠ L248), G203 (= G249), W205 (= W251), F209 (≠ A255), G300 (= G347), R302 (= R349), H327 (= H374), R329 (≠ H376), N330 (≠ H377), G331 (= G378), I332 (≠ L379)
- binding phosphate ion: R254 (= R304)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 33, 34, 35, 41, 42, 43, 46, 47, 48, 49
- binding phosphate ion: 89
6pxsA Crystal structure of iminodiacetate oxidase (idaa) from chelativorans sp. Bnc1 (see paper)
24% identity, 99% coverage: 5:414/414 of query aligns to 3:367/370 of 6pxsA
- binding flavin-adenine dinucleotide: G7 (= G9), G9 (= G11), I10 (= I12), D30 (= D32), N32 (≠ K34), H33 (≠ L35), K36 (≠ N38), A37 (≠ E39), T38 (= T40), A40 (≠ F42), G41 (= G43), A42 (= A45), G43 (= G46), V44 (≠ L47), Y174 (≠ W230), A203 (≠ L248), W206 (= W251), I210 (≠ A255), Y250 (≠ L295), G305 (= G347), R307 (= R349), G333 (≠ A375), A334 (≠ H376), S335 (≠ H377), G336 (= G378), L337 (= L379), T338 (= T380)
5fjnA Structure of l-amino acid deaminase from proteus myxofaciens in complex with anthranilate (see paper)
26% identity, 53% coverage: 193:412/414 of query aligns to 169:447/447 of 5fjnA
- active site: L252 (= L265)
- binding 2-aminobenzoic acid: L252 (= L265), R289 (≠ P286), V411 (≠ A375), W412 (≠ H376)
- binding flavin-adenine dinucleotide: V201 (vs. gap), G230 (≠ L248), G231 (= G249), W233 (= W251), L252 (= L265), Q254 (≠ V267), F343 (vs. gap), V385 (≠ R349), T410 (≠ H374), V411 (≠ A375), W412 (≠ H376), G413 (= G378), M414 (≠ L379), T415 (= T380)
Sites not aligning to the query:
- active site: 67, 71, 72
- binding flavin-adenine dinucleotide: 34, 35, 37, 38, 39, 57, 58, 59, 65, 66, 67, 70, 71, 72, 73
5fjmA Structure of l-amino acid deaminase from proteus myxofaciens (see paper)
26% identity, 53% coverage: 193:412/414 of query aligns to 169:447/447 of 5fjmA
- active site: L252 (= L265)
- binding flavin-adenine dinucleotide: V201 (vs. gap), G230 (≠ L248), G231 (= G249), W233 (= W251), L252 (= L265), Q254 (≠ V267), F343 (vs. gap), V385 (≠ R349), T410 (≠ H374), V411 (≠ A375), W412 (≠ H376), G413 (= G378), M414 (≠ L379), T415 (= T380)
Sites not aligning to the query:
- active site: 67, 71, 72
- binding flavin-adenine dinucleotide: 34, 35, 37, 38, 39, 57, 58, 59, 65, 66, 67, 70, 71, 72, 73
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
23% identity, 62% coverage: 141:396/414 of query aligns to 87:347/363 of 7cyxA
- binding flavin-adenine dinucleotide: V171 (≠ I220), G200 (≠ L248), G201 (= G249), W203 (= W251), G298 (= G347), R300 (= R349), P301 (= P350), Y326 (≠ A375), R327 (≠ H376), N328 (≠ H377), G329 (= G378), I330 (≠ L379)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 8, 10, 11, 12, 30, 31, 32, 38, 39, 40, 43, 45, 46
6j39A Crystal structure of cmis2 with inhibitor (see paper)
28% identity, 60% coverage: 164:410/414 of query aligns to 116:368/368 of 6j39A
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: R243 (≠ H285), Y252 (= Y294), Y267 (vs. gap), R308 (= R349), R334 (≠ H376), I335 (≠ H377)
- binding flavin-adenine dinucleotide: A174 (vs. gap), A203 (= A241), W206 (= W251), I228 (vs. gap), Y252 (= Y294), R308 (= R349), S333 (≠ A375), R334 (≠ H376), I335 (≠ H377), G336 (= G378), V337 (≠ L379), Q338 (≠ T380)
Sites not aligning to the query:
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: 44, 46, 49
- binding flavin-adenine dinucleotide: 7, 9, 10, 11, 29, 30, 31, 32, 36, 37, 38, 40, 41, 42, 43, 44
6j38A Crystal structure of cmis2 (see paper)
28% identity, 60% coverage: 164:410/414 of query aligns to 116:368/368 of 6j38A
- binding flavin-adenine dinucleotide: A174 (vs. gap), A203 (= A241), W206 (= W251), G226 (= G270), G306 (= G347), R308 (= R349), S333 (≠ A375), R334 (≠ H376), I335 (≠ H377), G336 (= G378), V337 (≠ L379), Q338 (≠ T380)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 9, 11, 29, 30, 31, 36, 37, 38, 41, 42, 43, 44
5hxwA L-amino acid deaminase from proteus vulgaris (see paper)
31% identity, 23% coverage: 317:410/414 of query aligns to 341:433/433 of 5hxwA
- binding cetyl-trimethyl-ammonium: M373 (≠ R349), E379 (≠ M355), G399 (≠ A375), W400 (≠ H376)
- binding flavin-adenine dinucleotide: G371 (= G347), M373 (≠ R349), T398 (≠ H374), G399 (≠ A375), W400 (≠ H376), G401 (= G378), M402 (≠ L379), T403 (= T380)
Sites not aligning to the query:
- active site: 58, 61, 62, 240, 284, 288
- binding cetyl-trimethyl-ammonium: 291, 294, 310, 311, 317, 318, 320
- binding flavin-adenine dinucleotide: 22, 23, 25, 26, 27, 46, 47, 53, 54, 55, 57, 58, 59, 60, 61, 188, 189, 218, 219, 221, 240, 242, 331
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
20% identity, 95% coverage: 20:412/414 of query aligns to 22:370/374 of 1y56B
- active site: F44 (= F42), G47 (= G63), T48 (= T64), H224 (= H272), P239 (≠ H285), G305 (= G347), M338 (≠ T380)
- binding flavin-adenine dinucleotide: I33 (≠ V31), E34 (≠ D32), K35 (≠ R33), S42 (≠ T40), T43 (≠ S41), R45 (≠ G43), C46 (≠ L62), G47 (= G63), G49 (≠ L65), E170 (vs. gap), V171 (vs. gap), T200 (≠ L248), N201 (≠ G249), W203 (= W251), G305 (= G347), Y306 (≠ R348), Y307 (≠ R349), G334 (≠ H376), H335 (= H377), G336 (= G378), F337 (≠ L379), M338 (≠ T380)
- binding flavin mononucleotide: F44 (= F42), R45 (≠ G43), I260 (≠ G308), R301 (≠ E343), W303 (= W345)
Sites not aligning to the query:
Query Sequence
>BPHYT_RS22250 FitnessBrowser__BFirm:BPHYT_RS22250
MKFDTVVLGAGIVGVCTAVHLQKRGRQVALVDRKLPGNETSFGNAGLIQREGVYPYAFPR
GLGTLLRYARNQSPDVRYHADAIVKTAPFLWQYWRNSHPTRHAAIAKSYATLIEHCVSEH
RALAADAGASALLRPIGWIKVFRTAAARDAETRLAERWHREYEVAFEALDAARLQQLEPD
LDKTLLGGLRYPESDSVSDPNALVTAYARYFEALGGRFFIGDADTLRDGWQVDTQAGTIS
ASSAVVALGPWSERASARLGYRLPLAVKRGYHMHYSAQGMARLNHPVLDAEGGYLLAPMA
RGIRLTTGAEIADLEAPKTPAQLAAVEPVARTLFPLGERLDDEPWMGRRPCTADMLPIIG
PAKKHPGLWFAFGHAHHGLTLGPVTGRLIAEMMTGEATLVDPRPFSVERFARHG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory