Comparing BPHYT_RS24200 FitnessBrowser__BFirm:BPHYT_RS24200 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
P70994 2-hydroxymuconate tautomerase; (2Z,4E)-2-hydroxyhexa-2,4-dienedioate keto-enol isomerase; 4-oxalocrotonate tautomerase; 4-OT; EC 5.3.2.6 from Bacillus subtilis (strain 168) (see paper)
33% identity, 98% coverage: 1:60/61 of query aligns to 1:60/62 of P70994
2opaA Ywhb binary complex with 2-fluoro-p-hydroxycinnamate
32% identity, 97% coverage: 2:60/61 of query aligns to 1:59/61 of 2opaA
Sites not aligning to the query:
Q01468 2-hydroxymuconate tautomerase; 4-oxalocrotonate tautomerase; 4-OT; EC 5.3.2.6 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
34% identity, 97% coverage: 1:59/61 of query aligns to 1:59/63 of Q01468
>BPHYT_RS24200 FitnessBrowser__BFirm:BPHYT_RS24200
MPTFRIELFEGRSVEQKRQFVEAITKATCESLGVEPNSVDIILTDVKRENWATAGRLWSD
A
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory