Comparing BPHYT_RS30445 FitnessBrowser__BFirm:BPHYT_RS30445 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4oanA Crystal structure of a trap periplasmic solute binding protein from rhodopseudomonas palustris haa2 (rpb_2686), target efi-510221, with density modeled as (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2- acetolactate) (see paper)
62% identity, 90% coverage: 36:346/347 of query aligns to 1:311/312 of 4oanA
4mnpA Structure of the sialic acid binding protein from fusobacterium nucleatum subsp. Nucleatum atcc 25586 (see paper)
31% identity, 82% coverage: 48:332/347 of query aligns to 12:290/305 of 4mnpA
4mmpA Structure of sialic acid binding protein from pasturella multocida (see paper)
34% identity, 77% coverage: 66:333/347 of query aligns to 28:293/308 of 4mmpA
Sites not aligning to the query:
4pakA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)- pantoic acid (see paper)
33% identity, 73% coverage: 67:319/347 of query aligns to 30:282/304 of 4pakA
Sites not aligning to the query:
4p9kA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d- erythronate with residual density suggestive of superposition with copurified alternative ligand. (see paper)
33% identity, 73% coverage: 67:319/347 of query aligns to 29:281/303 of 4p9kA
Sites not aligning to the query:
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
30% identity, 78% coverage: 64:334/347 of query aligns to 24:292/303 of 4pddA
Sites not aligning to the query:
4xfeA Crystal structure of a trap periplasmic solute binding protein from pseudomonas putida f1 (pput_1203), target efi-500184, with bound d- glucuronate
28% identity, 86% coverage: 45:341/347 of query aligns to 4:294/306 of 4xfeA
Q16BC9 Solute-binding protein RD1_1052 from Roseobacter denitrificans (strain ATCC 33942 / OCh 114) (Erythrobacter sp. (strain OCh 114)) (Roseobacter denitrificans) (see paper)
32% identity, 76% coverage: 46:310/347 of query aligns to 36:295/325 of Q16BC9
4pcdA Crystal structure of a trap periplasmic solute binding protein from roseobacter denitrificans och 114 (rd1_1052, target efi-510238) with bound l-galactonate (see paper)
32% identity, 76% coverage: 46:310/347 of query aligns to 12:271/300 of 4pcdA
4pc9A Crystal structure of a trap periplasmic solute binding protein from rosenbacter denitrificans och 114 (rd1_1052, target efi-510238) with bound d-mannonate (see paper)
32% identity, 76% coverage: 46:310/347 of query aligns to 12:271/300 of 4pc9A
P44542 Sialic acid-binding periplasmic protein SiaP; Extracytoplasmic solute receptor protein SiaP; N-acetylneuraminic-binding protein; Neu5Ac-binding protein from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
33% identity, 62% coverage: 66:281/347 of query aligns to 50:265/329 of P44542
Sites not aligning to the query:
2v4cA Structure of sialic acid binding protein (siap) in the presence of kdn (see paper)
34% identity, 62% coverage: 67:281/347 of query aligns to 28:242/309 of 2v4cA
2cexA Structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en (see paper)
33% identity, 62% coverage: 66:281/347 of query aligns to 26:241/304 of 2cexA
Sites not aligning to the query:
3b50A Structure of h. Influenzae sialic acid binding protein bound to neu5ac. (see paper)
33% identity, 62% coverage: 66:281/347 of query aligns to 27:242/310 of 3b50A
Sites not aligning to the query:
2cexB Structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en (see paper)
33% identity, 62% coverage: 66:281/347 of query aligns to 26:241/305 of 2cexB
Sites not aligning to the query:
2wx9A Crystal structure of the sialic acid binding periplasmic protein siap (see paper)
33% identity, 62% coverage: 66:281/347 of query aligns to 27:242/308 of 2wx9A
Sites not aligning to the query:
2xwoA Siap r147e mutant in complex with sialylamide (see paper)
33% identity, 62% coverage: 66:281/347 of query aligns to 27:242/308 of 2xwoA
Sites not aligning to the query:
7a5qB Crystal structure of vcsiap bound to sialic acid (see paper)
30% identity, 77% coverage: 67:332/347 of query aligns to 27:289/299 of 7a5qB
Sites not aligning to the query:
7a5qA Crystal structure of vcsiap bound to sialic acid (see paper)
30% identity, 77% coverage: 67:332/347 of query aligns to 27:289/299 of 7a5qA
Sites not aligning to the query:
4magA Crystal structure of the periplasmic sialic acid binding protein from vibrio cholerea (see paper)
30% identity, 77% coverage: 67:332/347 of query aligns to 27:289/307 of 4magA
Sites not aligning to the query:
>BPHYT_RS30445 FitnessBrowser__BFirm:BPHYT_RS30445
MTTRSNAPQGISRRSFLKAGATLSAAVPLWSVSRRAMAAPEFSYKLATGQDPTHPVNIRA
QEAINHIREATNGRLDIKLFPQNQLGSDTDLLSQVRNGGVEFFNQASSILATLTPAAGIV
NTGFAFKDYDAVWKAMDGDLGNYIRGQIGKSGLVSVSKVWDNGFRQISSSTRALRAPADL
KGFKIRVPQAPMLTSLFKALDAGPAPINFNELYSALQTGVVEGQENPLPIIATAKLYEVQ
KYISLTSHVWDGYWILGNRAAWERLPAEMRTIVTREFEKAAMLQRADIAKLSGSLRDDLK
AKGITFIDVDRESFRAALAKTSFYHDWKSKYGDEAWGLLEKSVGKLG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory