Comparing BPHYT_RS30855 FitnessBrowser__BFirm:BPHYT_RS30855 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
7x0hA Crystal structure of sugar binding protein cbpa complexed wtih glucose from clostridium thermocellum (see paper)
26% identity, 80% coverage: 50:337/362 of query aligns to 6:285/287 of 7x0hA
5hqjA Crystal structure of abc transporter solute binding protein b1g1h7 from burkholderia graminis c4d1m, target efi-511179, in complex with d-arabinose
27% identity, 75% coverage: 67:337/362 of query aligns to 18:287/289 of 5hqjA
Sites not aligning to the query:
6gt9A Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with galactose
27% identity, 77% coverage: 55:331/362 of query aligns to 7:278/283 of 6gt9A
6guqA Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with glucose
27% identity, 77% coverage: 55:331/362 of query aligns to 2:273/278 of 6guqA
2h3hA Crystal structure of the liganded form of thermotoga maritima glucose binding protein (see paper)
27% identity, 76% coverage: 64:339/362 of query aligns to 10:294/313 of 2h3hA
Sites not aligning to the query:
3c6qC Apo and ligand-bound form of a thermophilic glucose/xylose binding protein
27% identity, 76% coverage: 64:339/362 of query aligns to 10:294/305 of 3c6qC
Sites not aligning to the query:
5dkvA Crystal structure of an abc transporter solute binding protein from agrobacterium vitis(avis_5339, target efi-511225) bound with alpha-d- tagatopyranose
26% identity, 79% coverage: 52:336/362 of query aligns to 4:294/303 of 5dkvA
5xssA Xylfii molecule (see paper)
26% identity, 69% coverage: 56:304/362 of query aligns to 5:250/274 of 5xssA
4ru1A Crystal structure of carbohydrate transporter acei_1806 from acidothermus cellulolyticus 11b, target efi-510965, in complex with myo-inositol
28% identity, 64% coverage: 104:334/362 of query aligns to 53:276/288 of 4ru1A
Sites not aligning to the query:
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
25% identity, 67% coverage: 56:299/362 of query aligns to 4:251/287 of 5dteB
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
27% identity, 75% coverage: 65:334/362 of query aligns to 11:273/274 of 2ioyA
4rxtA Crystal structure of carbohydrate transporter solute binding protein arad_9553 from agrobacterium radiobacter, target efi-511541, in complex with d-arabinose
25% identity, 76% coverage: 64:339/362 of query aligns to 14:291/295 of 4rxtA
Sites not aligning to the query:
4irxA Crystal structure of caulobacter myo-inositol binding protein bound to myo-inositol (see paper)
21% identity, 74% coverage: 47:314/362 of query aligns to 1:269/296 of 4irxA
4wutA Crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis (avi_5133, target efi-511220) with bound d-fucose
23% identity, 69% coverage: 92:340/362 of query aligns to 40:270/290 of 4wutA
Sites not aligning to the query:
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
25% identity, 76% coverage: 64:337/362 of query aligns to 18:282/284 of 7e7mC
>BPHYT_RS30855 FitnessBrowser__BFirm:BPHYT_RS30855
MAQSKEDKDEVQGMRRGLLQGAGISAALALMGGMGGMISSAQAAEGGSFPAHKRWKIVFV
NHVTTNPFFVPTQYGIQDATALLGMDYQWTGSANADIGEMVNAVNAAIAAKADAIAVPIV
DPKAFDKPIQAALDAGIPVFAYNADAPSGSTNPRLAYIGQDLYLSGYQMGERIANLIDSG
LVALFIATPGQLNIQPRLDGAVAAIKKSGKKIDVQTIATGATVNEELSKIKSFYLGHQDL
KGMFAVDAGSTQGVAVTMKESNLPSKGVHGGGFDLLPRTVDLINEGFLDFTIDQQPYVQG
FYTVVQAFTFLASGGLVGPANVNTGLKFVTKGTVDPYLNTSTRYEGKSTKAQIVPRTGAI
KG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory