SitesBLAST
Comparing BPHYT_RS31145 FitnessBrowser__BFirm:BPHYT_RS31145 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4it1D Crystal structure of enolase pfl01_3283 (target efi-502286) from pseudomonas fluorescens pf0-1 with bound magnesium, potassium and tartrate
61% identity, 100% coverage: 3:424/424 of query aligns to 2:427/427 of 4it1D
- active site: S51 (≠ T52), D54 (= D55), A98 (≠ F97), Y150 (= Y149), K194 (= K193), K196 (= K195), D224 (= D223), N226 (= N225), Y247 (= Y246), E249 (= E248), T271 (= T270), N272 (= N271), M273 (= M272), D296 (= D295), H323 (= H322), S324 (= S323), N325 (= N324), C349 (= C348), D350 (= D349)
- binding magnesium ion: D224 (= D223), E249 (= E248), N272 (= N271)
3vc6A Crystal structure of enolase tbis_1083(target efi-502310) from thermobispora bispora dsm 43833 complexed with magnesium and formate
53% identity, 98% coverage: 7:421/424 of query aligns to 4:417/420 of 3vc6A
- active site: D52 (= D55), H55 (≠ M58), Y146 (= Y149), K188 (= K193), K190 (= K195), D218 (= D223), N220 (= N225), E243 (= E248), N266 (= N271), M267 (= M272), D290 (= D295), H317 (= H322), S318 (= S323), N319 (= N324), H321 (= H326), C343 (= C348), D344 (= D349)
- binding magnesium ion: D218 (= D223), E243 (= E248), N266 (= N271)
3va8A Crystal structure of enolase fg03645.1 (target efi-502278) from gibberella zeae ph-1 complexed with magnesium, formate and sulfate
50% identity, 100% coverage: 1:424/424 of query aligns to 7:427/427 of 3va8A
3nfuA Crystal structure of probable glucarate dehydratase from chromohalobacter salexigens dsm 3043 complexed with magnesium
37% identity, 98% coverage: 7:422/424 of query aligns to 5:437/441 of 3nfuA
- active site: K201 (= K193), K203 (= K195), D231 (= D223), N233 (= N225), E256 (= E248), N285 (= N271), D309 (= D295), H335 (= H322), N337 (= N324)
- binding magnesium ion: D231 (= D223), N233 (= N225), E256 (= E248), D257 (= D249), N285 (= N271)
1ecqA E. Coli glucarate dehydratase bound to 4-deoxyglucarate (see paper)
34% identity, 98% coverage: 7:423/424 of query aligns to 8:439/444 of 1ecqA
- active site: K203 (= K193), K205 (= K195), D233 (= D223), N235 (= N225), E258 (= E248), N287 (= N271), M288 (= M272), D311 (= D295), H337 (= H322), N339 (= N324), I363 (≠ C348)
- binding 4-deoxyglucarate: N25 (= N24), H30 (= H29), T101 (≠ E96), Y148 (= Y149), F150 (= F151), K205 (= K195), D233 (= D223), N235 (= N225), N287 (= N271), H337 (= H322), S338 (= S323), N339 (= N324), H366 (= H351), R420 (= R404)
- binding magnesium ion: D233 (= D223), E258 (= E248), N287 (= N271)
1ec9D E. Coli glucarate dehydratase bound to xylarohydroxamate (see paper)
34% identity, 98% coverage: 7:423/424 of query aligns to 8:439/444 of 1ec9D
- active site: K203 (= K193), K205 (= K195), D233 (= D223), N235 (= N225), E258 (= E248), N287 (= N271), M288 (= M272), D311 (= D295), H337 (= H322), N339 (= N324), I363 (≠ C348)
- binding magnesium ion: D233 (= D223), E258 (= E248), N287 (= N271)
- binding xylarohydroxamate: H30 (= H29), T101 (≠ E96), Y148 (= Y149), F150 (= F151), K205 (= K195), D233 (= D223), N235 (= N225), N287 (= N271), H337 (= H322), S338 (= S323), N339 (= N324), H366 (= H351), R420 (= R404)
P0AES2 Glucarate dehydratase; GDH; GlucD; D-glucarate dehydratase; EC 4.2.1.40 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 98% coverage: 7:423/424 of query aligns to 10:441/446 of P0AES2
- Y150 (= Y149) mutation to F: Reduces activity 100-fold.
- K207 (= K195) active site, Proton acceptor; mutation to Q: Reduces activity 1000-fold.; mutation to R: Reduces activity 10000-fold.
- D235 (= D223) binding
- E266 (vs. gap) binding
- N289 (= N271) binding
- H339 (= H322) active site, Proton acceptor; mutation to A: Loss of activity.; mutation to N: Reduces activity 10000-fold.; mutation to Q: Reduces activity 1000-fold.
- N341 (= N324) mutation to D: Inactive in the dehydration reaction of D-glucarate, L-idarate, and 4F-Gluc.; mutation to L: Almost no effect on the dehydration reaction of D-glucarate, L-idarate, and 4F-Gluc.
- D366 (= D349) mutation D->A,N: Reduces activity over 100-fold.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1ec8A E. Coli glucarate dehydratase bound to product 2,3-dihydroxy-5-oxo- hexanedioate (see paper)
34% identity, 98% coverage: 7:423/424 of query aligns to 6:437/442 of 1ec8A
- active site: K201 (= K193), K203 (= K195), D231 (= D223), N233 (= N225), E256 (= E248), N285 (= N271), M286 (= M272), D309 (= D295), H335 (= H322), N337 (= N324), I361 (≠ C348)
- binding 2,3-dihydroxy-5-oxo-hexanedioate: N23 (= N24), H28 (= H29), T99 (≠ E96), Y146 (= Y149), K203 (= K195), D231 (= D223), N233 (= N225), N285 (= N271), H335 (= H322), S336 (= S323), N337 (= N324), H364 (= H351), R418 (= R404)
- binding magnesium ion: D231 (= D223), E256 (= E248), N285 (= N271)
3p0wB Crystal structure of d-glucarate dehydratase from ralstonia solanacearum complexed with mg and d-glucarate
35% identity, 97% coverage: 7:418/424 of query aligns to 5:420/428 of 3p0wB
- active site: K189 (= K193), K191 (= K195), D219 (= D223), N221 (= N225), E244 (= E248), N273 (= N271), D297 (= D295), H323 (= H322), N325 (= N324)
- binding d-glucarate: H27 (= H29), Y134 (= Y149), K191 (= K195), D219 (= D223), N221 (= N225), N273 (= N271), H323 (= H322), N325 (= N324), H352 (= H351), R406 (= R404)
- binding magnesium ion: D219 (= D223), E244 (= E248), N273 (= N271)
1jctA Glucarate dehydratase, n341l mutant orthorhombic form (see paper)
34% identity, 98% coverage: 7:423/424 of query aligns to 7:438/443 of 1jctA
- active site: K202 (= K193), K204 (= K195), D232 (= D223), N234 (= N225), E257 (= E248), N286 (= N271), M287 (= M272), D310 (= D295), H336 (= H322), L338 (≠ N324), I362 (≠ C348)
- binding d-glucarate: N24 (= N24), H29 (= H29), T100 (≠ E96), Y147 (= Y149), F149 (= F151), K204 (= K195), D232 (= D223), N286 (= N271), S337 (= S323), R419 (= R404)
- binding magnesium ion: D232 (= D223), E257 (= E248), N286 (= N271)
3nxlC Crystal structure of glucarate dehydratase from burkholderia cepacia complexed with magnesium
36% identity, 99% coverage: 7:424/424 of query aligns to 5:424/425 of 3nxlC
3n6hB Crystal structure of mandelate racemase/muconate lactonizing protein from actinobacillus succinogenes 130z complexed with magnesium/sulfate
33% identity, 98% coverage: 7:422/424 of query aligns to 6:426/432 of 3n6hB
- active site: K189 (= K193), K191 (= K195), D219 (= D223), N221 (= N225), E244 (= E248), N273 (= N271), D297 (= D295), H323 (= H322), N325 (= N324)
- binding magnesium ion: D219 (= D223), E244 (= E248), N273 (= N271)
3pfrA Crystal structure of d-glucarate dehydratase related protein from actinobacillus succinogenes complexed with d-glucarate
32% identity, 98% coverage: 7:422/424 of query aligns to 5:422/426 of 3pfrA
- active site: K185 (= K193), K187 (= K195), D215 (= D223), N217 (= N225), E240 (= E248), N269 (= N271), D293 (= D295), H319 (= H322), N321 (= N324)
- binding d-glucarate: N22 (= N24), H27 (= H29), Y130 (= Y149), F132 (= F151), K187 (= K195), D215 (= D223), N217 (= N225), N269 (= N271), H319 (= H322), S320 (= S323), N321 (= N324), H348 (= H351)
- binding magnesium ion: D215 (= D223), E240 (= E248), N269 (= N271)
3rcyF Crystal structure of mandelate racemase/muconate lactonizing enzyme- like protein from roseovarius sp. Tm1035
28% identity, 82% coverage: 37:385/424 of query aligns to 25:370/397 of 3rcyF
- active site: K165 (≠ D185), D167 (≠ Y187), R175 (≠ K195), G208 (≠ N227), H210 (≠ T229), E234 (= E248), G259 (≠ N271), E260 (≠ M272), Q281 (≠ L293), A283 (≠ D295), H310 (= H322), A313 (≠ S325), L332 (≠ T345), E335 (≠ C348)
- binding magnesium ion: E234 (= E248), E260 (≠ M272)
- binding alpha-D-ribofuranose: R85 (≠ A100), P86 (= P101), P239 (vs. gap), A266 (≠ E278), E267 (≠ D279)
3i6eA Crystal structure of muconate lactonizing enzyme from ruegeria pomeroyi.
29% identity, 65% coverage: 114:389/424 of query aligns to 89:349/356 of 3i6eA
- active site: S124 (≠ Y149), K149 (= K193), K151 (= K195), D179 (= D223), Y180 (≠ P224), N181 (= N225), Q182 (≠ A226), E205 (= E248), D230 (≠ N271), E231 (≠ M272), S232 (≠ V273), K254 (= K290), Y279 (≠ S320), G281 (≠ H322), D282 (≠ S323), M283 (≠ N324), C307 (= C348), E308 (≠ D349), F309 (≠ T350)
- binding magnesium ion: D179 (= D223), E205 (= E248), D230 (≠ N271)
3sjnA Crystal structure of enolase spea_3858 (target efi-500646) from shewanella pealeana with magnesium bound
27% identity, 84% coverage: 37:391/424 of query aligns to 29:369/373 of 3sjnA
- active site: S46 (≠ G54), L49 (≠ P57), T139 (≠ F151), K165 (= K193), G167 (≠ K195), M171 (≠ F199), D198 (= D223), A200 (≠ N225), E225 (= E248), I247 (≠ L268), G250 (≠ N271), E251 (≠ M272), S252 (≠ V273), Q272 (≠ L293), D274 (= D295), H301 (= H322), G302 (≠ S323), F303 (≠ N324), M325 (≠ A347), E326 (≠ C348), Q329 (≠ H351), S331 (≠ P353)
- binding magnesium ion: D198 (= D223), E225 (= E248), E251 (≠ M272)
3i4kA Crystal structure of muconate lactonizing enzyme from corynebacterium glutamicum
28% identity, 65% coverage: 114:389/424 of query aligns to 104:365/370 of 3i4kA
- active site: A139 (≠ G168), K165 (= K193), K167 (= K195), D196 (= D223), N198 (= N225), E222 (= E248), D247 (≠ T270), E248 (≠ N271), S249 (≠ M272), A269 (≠ V291), K271 (≠ L293), T272 (≠ S294), A298 (≠ N324), T299 (≠ S325), S300 (≠ H326), T324 (≠ C348), E325 (≠ D349), L326 (≠ T350)
- binding magnesium ion: D196 (= D223), E222 (= E248), D247 (≠ T270)
Sites not aligning to the query:
3dgbA Crystal structure of muconate lactonizing enzyme from pseudomonas fluorescens complexed with muconolactone (see paper)
29% identity, 65% coverage: 114:390/424 of query aligns to 105:367/371 of 3dgbA
- active site: T140 (≠ Y149), K166 (= K193), K168 (= K195), D197 (= D223), N199 (= N225), E223 (= E248), D248 (≠ N271), E249 (≠ M272), S250 (≠ V273), I251 (= I274), K272 (≠ D295), Y297 (≠ S320), G299 (≠ H322), T300 (≠ S323), M301 (≠ N324), H313 (= H336), T325 (≠ C348), E326 (≠ D349), L327 (≠ T350)
- binding magnesium ion: D197 (= D223), E223 (= E248), D248 (≠ N271)
- binding [(2S)-5-oxo-2,5-dihydrofuran-2-yl]acetic acid: T140 (≠ Y149), K166 (= K193), K168 (= K195), D197 (= D223), K272 (≠ D295), T300 (≠ S323), E326 (≠ D349), F328 (≠ H351)
Sites not aligning to the query:
3i6tB Crystal structure of muconate cycloisomerase from jannaschia sp.
27% identity, 66% coverage: 114:392/424 of query aligns to 101:362/364 of 3i6tB
- active site: S136 (≠ Y149), K161 (= K193), K163 (= K195), D191 (= D223), N193 (= N225), E217 (= E248), D242 (≠ N271), E243 (≠ M272), S262 (= S288), K264 (= K290), G291 (≠ H322), D292 (≠ S323), M293 (≠ N324), C317 (= C348), E318 (≠ D349), F319 (vs. gap)
- binding magnesium ion: D191 (= D223), E217 (= E248), D242 (≠ N271)
Sites not aligning to the query:
3my9A Crystal structure of a muconate cycloisomerase from azorhizobium caulinodans
28% identity, 84% coverage: 35:389/424 of query aligns to 25:350/357 of 3my9A
- active site: P44 (≠ G54), W45 (≠ D55), S124 (≠ K153), K149 (= K193), K151 (= K195), D180 (= D223), N182 (= N225), E206 (= E248), D231 (≠ N271), E232 (≠ M272), S233 (vs. gap), S253 (= S288), K255 (= K290), G282 (≠ H322), T283 (≠ S323), L284 (≠ N324), C308 (= C348), E309 (≠ D349), F310 (≠ T350)
- binding magnesium ion: E206 (= E248), A221 (= A261), L224 (≠ T264), D231 (≠ N271)
Query Sequence
>BPHYT_RS31145 FitnessBrowser__BFirm:BPHYT_RS31145
MTRDITVTQVRITPIAFRDGPLLNAAGIHEPWALRAIVELETSDGRVGISETYGDEPMLR
VLEQAKALVIGLSPFDLNRMEERVRAAIKPSSGAIEFELAPGSHSAKNAPKVISTLEVAM
LDLQGQIVGAPIVDLLGGKVRDAVPYSAYLFFKYAEHIDKPYAPDAWGEGLSADQIVAQA
RRMIDLYGFQSIKLKGGVFEPAHEIACMRALHRAFPGVPLRLDPNANWTLETSIAAAPEL
DELLEYYEDPCPGLAGMAELAKHTRLPLATNMVITTMEDFRRGAEMGSVKVLLSDHHYWG
GLRATQTLARMCKLWDLGMSMHSNSHLGISLMAMTHVAASIPNLTYACDTHYPWQEEEVI
KGGRVSFDNGAVRVPSAPGLGVELDRERLAELHAQYLTCGVRNRDDLKQMQKYDPSFSGK
NPRF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory