SitesBLAST
Comparing BPHYT_RS31690 FitnessBrowser__BFirm:BPHYT_RS31690 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6bfgA Crystal structure of monotopic membrane protein (s)-mandelate dehydrogenase (see paper)
35% identity, 97% coverage: 1:370/383 of query aligns to 6:372/373 of 6bfgA
- active site: Y129 (= Y123), D156 (= D151), H272 (= H268)
- binding flavin mononucleotide: Y24 (≠ T19), P77 (= P71), T78 (≠ M72), G79 (= G73), Q127 (= Q121), Y129 (= Y123), T154 (= T149), K248 (= K244), H272 (= H268), G273 (= G269), R275 (= R271), D301 (= D299), S302 (≠ G300), G303 (= G301), R305 (= R303), G324 (= G322), R325 (= R323)
P20932 (S)-mandelate dehydrogenase; MDH; L(+)-mandelate dehydrogenase; EC 1.1.99.31 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 3 papers)
35% identity, 97% coverage: 1:370/383 of query aligns to 8:374/393 of P20932
- PTG 79:81 (≠ PMG 71:73) binding
- G81 (= G73) mutation to A: 23-fold decrease in catalytic activity with mandelate as substrate and DCPIP as electron acceptor, but no change in affinity for mandelate. Shows a modestly higher reactivity with molecular oxygen.
- S108 (= S100) binding
- Q129 (= Q121) binding
- T156 (= T149) binding
- K250 (= K244) binding
- DSGFR 303:307 (≠ DGGVR 299:303) binding
- GR 326:327 (= GR 322:323) binding
6a24A The crystal structure of mandelate oxidase with 3-fluoropyruvate (see paper)
37% identity, 94% coverage: 3:362/383 of query aligns to 6:344/354 of 6a24A
- active site: Y126 (= Y123), D154 (= D151), H250 (= H268)
- binding flavin mononucleotide: P75 (= P71), V76 (≠ M72), A77 (≠ G73), Q124 (= Q121), Y126 (= Y123), T152 (= T149), K226 (= K244), H250 (= H268), G251 (= G269), R253 (= R271), D281 (= D299), G282 (= G300), G283 (= G301), R285 (= R303), G304 (= G322), R305 (= R323)
- binding pyruvic acid: R161 (= R158), H250 (= H268), R253 (= R271)
5zzqA The crystal structure of mandelate oxidase with (s)-4-hydroxymandelic acid (see paper)
37% identity, 94% coverage: 3:362/383 of query aligns to 6:344/355 of 5zzqA
- active site: Y126 (= Y123), D154 (= D151), H250 (= H268)
- binding flavin mononucleotide: P75 (= P71), V76 (≠ M72), A77 (≠ G73), Q124 (= Q121), Y126 (= Y123), T152 (= T149), K226 (= K244), H250 (= H268), R253 (= R271), D281 (= D299), G283 (= G301), R285 (= R303), G304 (= G322), R305 (= R323)
- binding (2S)-hydroxy(4-hydroxyphenyl)ethanoic acid: L106 (≠ A102), Y126 (= Y123), M158 (≠ A155), R161 (= R158), T200 (≠ I217), F204 (≠ M221), H250 (= H268), R253 (= R271)
6a08A The crystal structure of mandelate oxidase with benzoyl-formic acid (see paper)
35% identity, 94% coverage: 3:362/383 of query aligns to 7:324/335 of 6a08A
- active site: Y127 (= Y123), D155 (= D151), H230 (= H268)
- binding benzoyl-formic acid: A78 (≠ G73), Y127 (= Y123), V156 (= V152), W158 (≠ V154), M159 (≠ A155), M159 (≠ A155), F184 (≠ Y201), H230 (= H268), R233 (= R271)
- binding flavin mononucleotide: P76 (= P71), V77 (≠ M72), A78 (≠ G73), Q125 (= Q121), Y127 (= Y123), T153 (= T149), K206 (= K244), H230 (= H268), G231 (= G269), R233 (= R271), D261 (= D299), G263 (= G301), R265 (= R303), G284 (= G322), R285 (= R323)
- binding magnesium ion: D261 (= D299), G262 (= G300), I264 (≠ V302), L282 (≠ F320)
6a1aA Mandelate oxidase mutant-y128f with 4-hydroxymandelic acid (see paper)
35% identity, 94% coverage: 3:362/383 of query aligns to 7:324/335 of 6a1aA
- active site: F127 (≠ Y123), D155 (= D151), H230 (= H268)
- binding flavin mononucleotide: P76 (= P71), V77 (≠ M72), A78 (≠ G73), Q125 (= Q121), F127 (≠ Y123), T153 (= T149), K206 (= K244), H230 (= H268), R233 (= R271), D261 (= D299), G263 (= G301), R265 (= R303), G284 (= G322), R285 (= R323)
- binding (2S)-hydroxy(4-hydroxyphenyl)ethanoic acid: A40 (= A36), R43 (= R39), L107 (≠ A102), F127 (≠ Y123), V156 (= V152), M159 (≠ A155), R162 (= R158), F184 (≠ Y201), H230 (= H268), R233 (= R271), E243 (≠ D281)
Sites not aligning to the query:
6a01A The crystal structure of mandelate oxidase y128f with 3,3-difluoro-2, 2-dihydroxy-3-phenylpropionic acid (see paper)
35% identity, 94% coverage: 3:362/383 of query aligns to 6:323/333 of 6a01A
- active site: F126 (≠ Y123), D154 (= D151), H229 (= H268)
- binding 3,3-difluoro-2,2-dihydroxy-3-phenylpropanoic acid: F22 (≠ T19), F126 (≠ Y123), M158 (≠ A155), R161 (= R158), H229 (= H268), R232 (= R271)
- binding flavin mononucleotide: P75 (= P71), V76 (≠ M72), A77 (≠ G73), Q124 (= Q121), F126 (≠ Y123), T152 (= T149), K205 (= K244), H229 (= H268), R232 (= R271), D260 (= D299), G262 (= G301), R264 (= R303), G283 (= G322), R284 (= R323)
6gmcA 1.2 a resolution structure of human hydroxyacid oxidase 1 bound with fmn and 4-carboxy-5-[(4-chlorophenyl)sulfanyl]-1,2,3-thiadiazole
33% identity, 95% coverage: 1:363/383 of query aligns to 8:353/360 of 6gmcA
- active site: Y132 (= Y123), D160 (= D151), H258 (= H268)
- binding 5-[(4-chlorophenyl)sulfanyl]-1,2,3-thiadiazole-4-carboxylate: Y26 (≠ T19), M82 (≠ L74), W110 (≠ A102), Y132 (= Y123), R167 (= R158), F191 (≠ Y201), L203 (≠ A213), Y206 (≠ H216), H258 (= H268), R261 (= R271)
- binding flavin mononucleotide: Y26 (≠ T19), Y27 (≠ L20), A79 (≠ P71), T80 (≠ M72), A81 (≠ G73), S108 (= S100), Q130 (= Q121), Y132 (= Y123), T158 (= T149), K234 (= K244), H258 (= H268), G259 (= G269), R261 (= R271), D289 (= D299), G290 (= G300), R293 (= R303), G312 (= G322), R313 (= R323)
5qigA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z1407672867
33% identity, 95% coverage: 1:363/383 of query aligns to 5:352/359 of 5qigA
- active site: Y129 (= Y123), D157 (= D151), H257 (= H268)
- binding flavin mononucleotide: Y23 (≠ T19), Y24 (≠ L20), A76 (≠ P71), T77 (≠ M72), A78 (≠ G73), S105 (= S100), Q127 (= Q121), Y129 (= Y123), T155 (= T149), K233 (= K244), H257 (= H268), G258 (= G269), R260 (= R271), D288 (= D299), G289 (= G300), G290 (= G301), R292 (= R303), G311 (= G322), R312 (= R323)
- binding 2-cyclopropyl-1~{H}-imidazole-4-carboxamide: R223 (= R234), G248 (= G259), F320 (≠ A331), K324 (≠ R335), D328 (≠ A339)
Sites not aligning to the query:
5qifA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z31792168
33% identity, 95% coverage: 1:363/383 of query aligns to 5:352/359 of 5qifA
- active site: Y129 (= Y123), D157 (= D151), H257 (= H268)
- binding flavin mononucleotide: Y23 (≠ T19), Y24 (≠ L20), A76 (≠ P71), T77 (≠ M72), A78 (≠ G73), S105 (= S100), Q127 (= Q121), Y129 (= Y123), K233 (= K244), H257 (= H268), G258 (= G269), R260 (= R271), D288 (= D299), G289 (= G300), R292 (= R303), G311 (= G322), R312 (= R323)
- binding 2-cyclohexyl-~{N}-pyridin-3-yl-ethanamide: R223 (= R234), R224 (≠ A235), S227 (≠ P238)
2rdwA Crystal structure of human glycolate oxidase in complex with sulfate (see paper)
33% identity, 95% coverage: 1:363/383 of query aligns to 5:352/359 of 2rdwA
- active site: S105 (= S100), Y129 (= Y123), T155 (= T149), D157 (= D151), K233 (= K244), H257 (= H268)
- binding flavin mononucleotide: Y23 (≠ T19), Y24 (≠ L20), A76 (≠ P71), T77 (≠ M72), A78 (≠ G73), Q127 (= Q121), Y129 (= Y123), T155 (= T149), K233 (= K244), H257 (= H268), G258 (= G269), R260 (= R271), D288 (= D299), G289 (= G300), R292 (= R303), G311 (= G322), R312 (= R323)
- binding sulfate ion: Y23 (≠ T19), W107 (≠ A102), R164 (= R158), H257 (= H268), R260 (= R271)
2rduA Crystal structure of human glycolate oxidase in complex with glyoxylate (see paper)
33% identity, 95% coverage: 1:363/383 of query aligns to 6:353/360 of 2rduA
- active site: S106 (= S100), Y130 (= Y123), T156 (= T149), D158 (= D151), K234 (= K244), H258 (= H268)
- binding flavin mononucleotide: Y24 (≠ T19), Y25 (≠ L20), A77 (≠ P71), T78 (≠ M72), A79 (≠ G73), S106 (= S100), Q128 (= Q121), Y130 (= Y123), T156 (= T149), K234 (= K244), H258 (= H268), G259 (= G269), R261 (= R271), D289 (= D299), G290 (= G300), G291 (= G301), R293 (= R303), G312 (= G322), R313 (= R323)
- binding glyoxylic acid: Y24 (≠ T19), W108 (≠ A102), Y130 (= Y123), R165 (= R158), H258 (= H268), R261 (= R271)
Q9UJM8 2-Hydroxyacid oxidase 1; HAOX1; Glycolate oxidase; GO; GOX; Glyoxylate oxidase; EC 1.1.3.15; EC 1.2.3.5 from Homo sapiens (Human) (see 2 papers)
33% identity, 95% coverage: 1:363/383 of query aligns to 8:355/370 of Q9UJM8
1huvA Crystal structure of a soluble mutant of the membrane-associated (s)- mandelate dehydrogenase from pseudomonas putida at 2.15a resolution (see paper)
33% identity, 97% coverage: 1:370/383 of query aligns to 5:348/349 of 1huvA
- active site: S105 (= S100), Y128 (= Y123), T153 (= T149), D155 (= D151), K224 (= K244), H248 (= H268)
- binding flavin mononucleotide: Y23 (≠ T19), P76 (= P71), T77 (≠ M72), G78 (= G73), S105 (= S100), Q126 (= Q121), Y128 (= Y123), T153 (= T149), K224 (= K244), H248 (= H268), G249 (= G269), R251 (= R271), D277 (= D299), S278 (≠ G300), G279 (= G301), R281 (= R303), G300 (= G322), R301 (= R323)
6gmbA Structure of human hydroxyacid oxidase 1 bound with fmn and glycolate
33% identity, 95% coverage: 1:363/383 of query aligns to 8:355/362 of 6gmbA
- active site: Y132 (= Y123), D160 (= D151), H260 (= H268)
- binding flavin mononucleotide: Y26 (≠ T19), Y27 (≠ L20), A79 (≠ P71), T80 (≠ M72), A81 (≠ G73), S108 (= S100), Q130 (= Q121), Y132 (= Y123), K236 (= K244), H260 (= H268), G261 (= G269), R263 (= R271), D291 (= D299), G292 (= G300), G293 (= G301), R295 (= R303), G314 (= G322), R315 (= R323)
- binding glycolic acid: Y26 (≠ T19), W110 (≠ A102), Y132 (= Y123), R167 (= R158), H260 (= H268), R263 (= R271)
7bsrA Mandelate oxidase with the 2-hydroxy-3-oxosuccinic acid (see paper)
35% identity, 94% coverage: 3:362/383 of query aligns to 4:320/330 of 7bsrA
- active site: F124 (≠ Y123), D152 (= D151), H226 (= H268)
- binding (2~{S})-2-oxidanyl-3-oxidanylidene-butanedioic acid: R159 (= R158), H226 (= H268), R229 (= R271)
- binding 3-pyridin-4-yl-2,4-dihydro-indeno[1,2-.c.]pyrazole: L21 (= L20), P73 (= P71), V74 (≠ M72), Q122 (= Q121), F124 (≠ Y123), T150 (= T149), K202 (= K244), H226 (= H268), R229 (= R271), D257 (= D299), R261 (= R303), G280 (= G322), R281 (= R323)
6a4hA Mandelate oxidase mutant-y128f with the peroxide fmn adduct (see paper)
35% identity, 94% coverage: 3:362/383 of query aligns to 3:319/329 of 6a4hA
- active site: F123 (≠ Y123), D151 (= D151), H225 (= H268)
- binding [(2~{R},3~{S},4~{S})-5-[(4~{a}~{S})-4~{a}-(dioxidanyl)-7,8-dimethyl-2,4-bis(oxidanylidene)-5~{H}-benzo[g]pteridin-10-yl]-2,3,4-tris(oxidanyl)pentyl] dihydrogen phosphate: L20 (= L20), P72 (= P71), C101 (≠ S100), F123 (≠ Y123), T149 (= T149), K201 (= K244), H225 (= H268), R228 (= R271), D256 (= D299), G257 (= G300), G258 (= G301), R260 (= R303), R280 (= R323)
5qieA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z2856434894
33% identity, 95% coverage: 1:363/383 of query aligns to 5:346/353 of 5qieA
- active site: Y129 (= Y123), D157 (= D151), H251 (= H268)
- binding flavin mononucleotide: Y23 (≠ T19), Y24 (≠ L20), A76 (≠ P71), T77 (≠ M72), A78 (≠ G73), S105 (= S100), Q127 (= Q121), Y129 (= Y123), K227 (= K244), H251 (= H268), G252 (= G269), R254 (= R271), D282 (= D299), G283 (= G300), R286 (= R303), G305 (= G322), R306 (= R323)
- binding ~{N},~{N}-dimethyl-4-[(propan-2-ylamino)methyl]aniline: D322 (≠ A339)
Sites not aligning to the query:
2a85A Crystal structure of the g81a mutant of the active chimera of (s)- mandelate dehydrogenase in complex with its substrate 2- hydroxyoctanoate (see paper)
33% identity, 97% coverage: 1:370/383 of query aligns to 5:352/353 of 2a85A
- active site: S105 (= S100), Y128 (= Y123), T153 (= T149), D155 (= D151), K228 (= K244), H252 (= H268)
- binding flavin mononucleotide: Y23 (≠ T19), P76 (= P71), T77 (≠ M72), A78 (≠ G73), S105 (= S100), Q126 (= Q121), Y128 (= Y123), T153 (= T149), K228 (= K244), H252 (= H268), G253 (= G269), R255 (= R271), D281 (= D299), S282 (≠ G300), G283 (= G301), R285 (= R303), G304 (= G322), R305 (= R323)
- binding (2s)-2-hydroxyoctanoic acid: Y128 (= Y123), N159 (≠ A155), G160 (= G156), R162 (= R158), H252 (= H268), R255 (= R271)
2a7pA Crystal structure of the g81a mutant of the active chimera of (s)- mandelate dehydrogenase in complex with its substrate 3-indolelactate (see paper)
33% identity, 97% coverage: 1:370/383 of query aligns to 5:352/353 of 2a7pA
- active site: S105 (= S100), Y128 (= Y123), T153 (= T149), D155 (= D151), K228 (= K244), H252 (= H268)
- binding 3-(indol-3-yl) lactate: Y128 (= Y123), R162 (= R158), H252 (= H268)
- binding flavin mononucleotide: Y23 (≠ T19), P76 (= P71), T77 (≠ M72), A78 (≠ G73), S105 (= S100), Q126 (= Q121), Y128 (= Y123), T153 (= T149), K228 (= K244), H252 (= H268), G253 (= G269), R255 (= R271), D281 (= D299), S282 (≠ G300), G283 (= G301), R285 (= R303), G304 (= G322), R305 (= R323)
Query Sequence
>BPHYT_RS31690 FitnessBrowser__BFirm:BPHYT_RS31690
MRDFVEPARKHLPAFAFNTLAGGAGNDAGVAENEAAFGRRFFVSRRFAPASTDQTATVFG
HSYASPFGVAPMGLANLFYPGADLLLAQAAQAGNFPFVLSTAASTSIERITKVAPDVSWY
QLYLLSDDRLNAELLSRVAGCGVAVLVLTVDVPVAGRRNSAIRDGVTLPLRWTSALLADV
MRRPQWALGMLRHGAPKLENYAPHAGTADVGAASRHIASVMKMGLEWDDLKKVRAMWPGK
LVIKGILHPDDAARSVALGADGIWVSNHGGRQLEGAIASLDALSEIRRAVGRDTAVFLDG
GVRTGEDILKACALGAGLCFSGRSFAFPVAAYGERGVRAAVEILKEEIRVGLAQLGVQSL
SALTSDSLSNVTRASTPGDPFES
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory