SitesBLAST
Comparing BPHYT_RS32435 FitnessBrowser__BFirm:BPHYT_RS32435 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AAJ3 Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit; Anaerobic formate dehydrogenase iron-sulfur subunit; Formate dehydrogenase-N subunit beta; FDH-N subunit beta from Escherichia coli (strain K12) (see paper)
68% identity, 95% coverage: 1:295/310 of query aligns to 1:294/294 of P0AAJ3
- C39 (= C38) binding
- C42 (= C41) binding
- C45 (= C44) binding
- C49 (= C48) binding
- C100 (= C100) binding
- C103 (= C103) binding
- C108 (= C108) binding
- C112 (= C112) binding
- C133 (= C133) binding
- C136 (= C136) binding
- C139 (= C139) binding
- C143 (= C143) binding
- C160 (= C160) binding
- C163 (= C163) binding
- C175 (= C175) binding
- C179 (= C179) binding
1kqfB Formate dehydrogenase n from e. Coli (see paper)
68% identity, 93% coverage: 2:289/310 of query aligns to 1:288/289 of 1kqfB
- binding protoporphyrin ix containing fe: Y137 (= Y138), W252 (= W253)
- binding iron/sulfur cluster: K31 (= K31), C38 (= C38), I39 (= I39), G40 (= G40), C41 (= C41), K42 (= K42), C44 (= C44), C48 (= C48), N52 (= N52), T77 (= T77), M79 (= M79), C99 (= C100), M100 (= M101), H101 (= H102), C102 (= C103), P105 (= P106), C107 (= C108), C111 (= C112), P112 (= P113), I117 (= I118), V125 (= V126), C132 (= C133), I133 (= I134), G134 (= G135), C135 (= C136), G136 (= G137), Y137 (= Y138), C138 (= C139), C142 (= C143), I146 (= I147), P147 (= P148), V156 (≠ A157), K158 (= K159), C159 (= C160), L161 (= L162), C162 (= C163), P172 (= P173), C174 (= C175), C178 (= C179), P179 (= P180), I183 (= I184)
8cm6D W-formate dehydrogenase c872a from desulfovibrio vulgaris - with formamide (see paper)
36% identity, 67% coverage: 32:240/310 of query aligns to 5:213/214 of 8cm6D
- binding formamide: R59 (≠ N86), P62 (≠ G89)
- binding iron/sulfur cluster: C11 (= C38), T12 (≠ I39), A13 (≠ G40), C14 (= C41), R15 (≠ K42), C17 (= C44), C21 (= C48), K25 (≠ N52), K50 (≠ T77), C73 (= C100), R74 (≠ M101), C76 (= C103), P79 (= P106), P80 (≠ G107), C81 (= C108), V102 (= V126), C120 (= C143), I124 (= I147), P125 (= P148), K136 (= K159), C137 (= C160), D138 (≠ T161), M139 (≠ L162), C140 (= C163), C152 (= C175), C156 (= C179), P157 (= P180), T158 (= T181), T160 (≠ A183), M161 (≠ I184)
Sites not aligning to the query:
8bqgB W-formate dehydrogenase from desulfovibrio vulgaris - soaking with formate 1 min (see paper)
36% identity, 67% coverage: 32:240/310 of query aligns to 5:213/214 of 8bqgB
- binding iron/sulfur cluster: C11 (= C38), T12 (≠ I39), A13 (≠ G40), C14 (= C41), R15 (≠ K42), C17 (= C44), C21 (= C48), K25 (≠ N52), K50 (≠ T77), C73 (= C100), R74 (≠ M101), C76 (= C103), P80 (≠ G107), C81 (= C108), V102 (= V126), C120 (= C143), I124 (= I147), P125 (= P148), K136 (= K159), C137 (= C160), M139 (≠ L162), C140 (= C163), C152 (= C175), C156 (= C179), P157 (= P180), T158 (= T181), T160 (≠ A183), M161 (≠ I184)
Sites not aligning to the query:
Q8GC87 Formate dehydrogenase subunit beta; FDH subunit beta; Formate dehydrogenase small subunit from Megalodesulfovibrio gigas (strain ATCC 19364 / DSM 1382 / NCIMB 9332 / VKM B-1759) (Desulfovibrio gigas) (see paper)
32% identity, 67% coverage: 32:238/310 of query aligns to 6:210/215 of Q8GC87
- C12 (= C38) binding
- C15 (= C41) binding
- C18 (= C44) binding
- C22 (= C48) binding
- C73 (= C100) binding
- C76 (= C103) binding
- C81 (= C108) binding
- C121 (= C143) binding
- C138 (= C160) binding
- C141 (= C163) binding
- C153 (= C175) binding
- C157 (= C179) binding
1h0hB Tungsten containing formate dehydrogenase from desulfovibrio gigas (see paper)
32% identity, 67% coverage: 32:238/310 of query aligns to 5:209/214 of 1h0hB
- binding iron/sulfur cluster: C11 (= C38), T12 (≠ I39), A13 (≠ G40), C14 (= C41), R15 (≠ K42), C17 (= C44), C21 (= C48), H25 (≠ N52), K50 (≠ T77), Q71 (≠ G99), C72 (= C100), R73 (≠ M101), C75 (= C103), P79 (≠ G107), C80 (= C108), V101 (vs. gap), C120 (= C143), P125 (= P148), K136 (= K159), C137 (= C160), D138 (≠ T161), M139 (≠ L162), C140 (= C163), C152 (= C175), C156 (= C179), P157 (= P180), A160 (= A183)
Sites not aligning to the query:
P18776 Anaerobic dimethyl sulfoxide reductase chain B; DMSO reductase iron-sulfur subunit from Escherichia coli (strain K12) (see 2 papers)
35% identity, 56% coverage: 25:198/310 of query aligns to 1:164/205 of P18776
- M1 (≠ V25) modified: Initiator methionine, Removed
- C102 (= C136) mutation C->F,S,W,Y: Loss of electron transfer from menaquinol to DMSO.
2vpyF Polysulfide reductase with bound quinone inhibitor, pentachlorophenol (pcp) (see paper)
33% identity, 60% coverage: 30:214/310 of query aligns to 5:177/193 of 2vpyF
- binding pentachlorophenol: I91 (= I134), C93 (= C136)
- binding iron/sulfur cluster: C13 (= C38), G15 (= G40), C16 (= C41), C19 (= C44), C23 (= C48), N27 (= N52), L36 (≠ I64), I38 (≠ D66), P55 (≠ K97), Q57 (≠ G99), C58 (= C100), L59 (≠ M101), C61 (= C103), P65 (≠ G107), C66 (= C108), C70 (= C112), P71 (= P113), V83 (= V126), C90 (= C133), I91 (= I134), A92 (≠ G135), C93 (= C136), G94 (= G137), C96 (= C139), C100 (= C143), P101 (= P144), Y102 (≠ F145), R105 (= R149), V113 (≠ A157), C116 (= C160), F118 (≠ L162), C119 (= C163), P129 (= P173), A130 (= A174), C131 (= C175), C135 (= C179), C139 (≠ A183), R140 (≠ I184)
Sites not aligning to the query:
2vpwF Polysulfide reductase with bound menaquinone (see paper)
33% identity, 60% coverage: 30:214/310 of query aligns to 5:177/193 of 2vpwF
- binding iron/sulfur cluster: C13 (= C38), G15 (= G40), C16 (= C41), C19 (= C44), C23 (= C48), N27 (= N52), L36 (≠ I64), I38 (≠ D66), P55 (≠ K97), Q57 (≠ G99), C58 (= C100), L59 (≠ M101), H60 (= H102), C61 (= C103), P65 (≠ G107), C66 (= C108), C70 (= C112), P71 (= P113), V83 (= V126), C90 (= C133), I91 (= I134), A92 (≠ G135), C93 (= C136), G94 (= G137), C96 (= C139), C100 (= C143), P101 (= P144), Y102 (≠ F145), R105 (= R149), V113 (≠ A157), C116 (= C160), F118 (≠ L162), C119 (= C163), P129 (= P173), A130 (= A174), C131 (= C175), C135 (= C179), C139 (≠ A183), R140 (≠ I184)
Sites not aligning to the query:
7qv7B Cryo-em structure of hydrogen-dependent co2 reductase. (see paper)
33% identity, 51% coverage: 36:194/310 of query aligns to 12:169/183 of 7qv7B
- binding iron/sulfur cluster: C14 (= C38), G16 (= G40), C17 (= C41), K18 (= K42), A19 (= A43), C20 (= C44), C24 (= C48), H28 (≠ N52), R48 (= R80), C63 (= C100), R64 (≠ M101), H65 (= H102), C66 (= C103), A69 (≠ P106), C71 (= C108), C75 (= C112), A79 (= A117), I80 (= I118), C94 (= C133), I95 (= I134), C97 (= C136), C100 (= C139), C104 (= C143), I109 (vs. gap), C139 (= C160), L141 (= L162), C142 (= C163), P148 (= P173), C150 (= C175), C154 (= C179), P155 (= P180), L159 (≠ I184)
5ch7B Crystal structure of the perchlorate reductase pcrab - phe164 gate switch intermediate - from azospira suillum ps (see paper)
26% identity, 56% coverage: 32:204/310 of query aligns to 11:237/329 of 5ch7B
- binding fe3-s4 cluster: C145 (= C112), I150 (≠ A117), C166 (= C133), K167 (≠ I134), G168 (= G135), A169 (≠ C136), Q170 (≠ G137), A171 (≠ Y138), C172 (= C139), A190 (= A157)
- binding iron/sulfur cluster: C17 (= C38), I18 (= I39), G19 (= G40), C20 (= C41), Q21 (≠ K42), C23 (= C44), C27 (= C48), W31 (vs. gap), R43 (≠ N52), V45 (≠ L54), P130 (≠ I95), C133 (= C100), N134 (≠ M101), C136 (= C103), P139 (= P106), C141 (= C108), C176 (= C143), C193 (= C160), G195 (≠ L162), C196 (= C163), C208 (= C175), C212 (= C179), V213 (≠ P180), G214 (≠ T181)
6cz7B The arsenate respiratory reductase (arr) complex from shewanella sp. Ana-3 (see paper)
24% identity, 64% coverage: 29:227/310 of query aligns to 3:225/234 of 6cz7B
- binding iron/sulfur cluster: C12 (= C38), V13 (≠ I39), G14 (= G40), C15 (= C41), G16 (≠ K42), C18 (= C44), C22 (= C48), N26 (= N52), Y52 (≠ I95), P54 (≠ K97), C57 (= C100), N58 (≠ M101), H59 (= H102), C60 (= C103), A63 (≠ P106), P64 (≠ G107), C65 (= C108), C69 (= C112), P70 (= P113), T82 (≠ V126), C89 (= C133), I90 (= I134), G91 (= G135), C92 (= C136), K93 (≠ G137), C95 (= C139), C99 (= C143), Y101 (≠ F145), V103 (≠ I147), I104 (vs. gap), T161 (vs. gap), K163 (= K159), C164 (= C160), F166 (≠ L162), C167 (= C163), C179 (= C175), C183 (= C179), P184 (= P180), R188 (≠ I184)
Q7WTT9 Arsenate respiratory reductase iron-sulfur subunit ArrB; Arsenate respiratory reductase small subunit; ARR small subunit from Shewanella sp. (strain ANA-3) (see paper)
24% identity, 64% coverage: 29:227/310 of query aligns to 3:225/234 of Q7WTT9
- C12 (= C38) binding
- C15 (= C41) binding
- C18 (= C44) binding
- C22 (= C48) binding
- C57 (= C100) binding
- C60 (= C103) binding
- C65 (= C108) binding
- C69 (= C112) binding
- C89 (= C133) binding
- C92 (= C136) binding
- C95 (= C139) binding
- C99 (= C143) binding
- C164 (= C160) binding
- C167 (= C163) binding
- C179 (= C175) binding
- C183 (= C179) binding
3egwB The crystal structure of the narghi mutant narh - c16a
25% identity, 56% coverage: 81:253/310 of query aligns to 169:354/509 of 3egwB
- binding fe3-s4 cluster: P181 (≠ I95), C196 (= C112), S198 (= S114), I201 (≠ A117), C217 (= C133), R218 (≠ I134), G219 (= G135), W220 (≠ C136), R221 (≠ G137), C223 (= C139), S241 (≠ A157), C263 (= C179), G265 (vs. gap), R268 (vs. gap)
- binding protoporphyrin ix containing fe: W220 (≠ C136), R221 (≠ G137)
- binding iron/sulfur cluster: C184 (= C100), E185 (≠ M101), H186 (= H102), C187 (= C103), P190 (= P106), C192 (= C108), C227 (= C143), I232 (≠ P148), K243 (= K159), C244 (= C160), F246 (≠ L162), C247 (= C163), T257 (≠ P173), C259 (= C175)
Sites not aligning to the query:
P11349 Respiratory nitrate reductase 1 beta chain; Nitrate reductase A subunit beta; Quinol-nitrate oxidoreductase subunit beta; EC 1.7.5.1 from Escherichia coli (strain K12) (see 2 papers)
25% identity, 56% coverage: 81:253/310 of query aligns to 169:354/512 of P11349
- C184 (= C100) binding
- C187 (= C103) binding
- C192 (= C108) binding
- C196 (= C112) binding
- C217 (= C133) binding
- C223 (= C139) binding
- C227 (= C143) binding
- C244 (= C160) binding
- C247 (= C163) binding
- C259 (= C175) binding
- C263 (= C179) binding
Sites not aligning to the query:
- 16 binding
- 19 binding
- 22 binding
- 26 binding
2ivfB Ethylbenzene dehydrogenase from aromatoleum aromaticum (see paper)
24% identity, 57% coverage: 29:204/310 of query aligns to 4:240/337 of 2ivfB
- binding fe3-s4 cluster: C148 (= C112), T150 (≠ S114), I153 (≠ A117), C169 (= C133), K170 (≠ I134), G171 (= G135), H172 (≠ C136), R173 (≠ G137), H174 (≠ Y138), C175 (= C139), S193 (≠ A157)
- binding protoporphyrin ix containing fe: T150 (≠ S114), K170 (≠ I134), H172 (≠ C136)
- binding iron/sulfur cluster: C13 (= C38), L14 (≠ I39), G15 (= G40), C16 (= C41), Q17 (≠ K42), C19 (= C44), C23 (= C48), W27 (vs. gap), W38 (= W51), N39 (= N52), V41 (≠ L54), M135 (vs. gap), C136 (= C100), N137 (≠ M101), H138 (= H102), C139 (= C103), P142 (= P106), C144 (= C108), V162 (= V126), C179 (= C143), A183 (≠ I147), I184 (≠ P148), K195 (= K159), C196 (= C160), I197 (≠ T161), L198 (= L162), C199 (= C163), N209 (≠ P173), C211 (= C175), C215 (= C179), V219 (≠ A183), R220 (≠ I184)
6f0kB Alternative complex iii (see paper)
26% identity, 52% coverage: 30:191/310 of query aligns to 725:918/961 of 6f0kB
- binding fe3-s4 cluster: C803 (= C112), V805 (≠ S114), M818 (≠ F128), C823 (= C133), I824 (= I134), G825 (= G135), C829 (= C139), M869 (≠ A157)
- binding heme c: N821 (≠ E131), R822 (≠ N132), R884 (vs. gap), N887 (vs. gap)
- binding iron/sulfur cluster: C733 (= C38), T734 (≠ I39), G735 (= G40), C736 (= C41), N737 (≠ K42), A738 (= A43), C739 (= C44), C743 (= C48), W765 (≠ S75), I768 (≠ V78), C791 (= C100), M792 (= M101), H793 (= H102), C794 (= C103), P798 (≠ G107), C799 (= C108), N816 (≠ V126), C833 (= C143), C872 (= C160), Y874 (≠ L162), C875 (= C163), A901 (= A174), C902 (= C175), C906 (= C179)
Sites not aligning to the query:
8c0zC Cryoem structure of a tungsten-containing aldehyde oxidoreductase from aromatoleum aromaticum (see paper)
31% identity, 50% coverage: 33:186/310 of query aligns to 7:133/158 of 8c0zC
- binding iron/sulfur cluster: C12 (= C38), T13 (≠ I39), C15 (= C41), C18 (= C44), C22 (= C48), C53 (= C100), C56 (= C103), C61 (= C108), C65 (= C112), I70 (≠ A117), C86 (= C133), C89 (= C136), C92 (= C139), C96 (= C143), T100 (≠ I147), K112 (= K159), C113 (= C160), C116 (= C163), C122 (= C175), C126 (= C179), T128 (= T181)
4v4cB Pyrogallol hydroxytransferase small subunit (see paper)
28% identity, 50% coverage: 32:186/310 of query aligns to 7:156/274 of 4v4cB
- binding calcium ion: I61 (≠ L91), N62 (≠ E92)
- binding iron/sulfur cluster: C13 (= C38), Q14 (≠ I39), D15 (≠ G40), C16 (= C41), N17 (≠ K42), N18 (≠ A43), C19 (= C44), C23 (= C48), C68 (= C100), M69 (= M101), H70 (= H102), C71 (= C103), C76 (= C108), V92 (= V126), C109 (= C143), V113 (≠ I147), C126 (= C160), M128 (≠ L162), C129 (= C163), P143 (= P173), C145 (= C175), C149 (= C179), S151 (≠ T181), V153 (≠ A183), Y154 (≠ I184)
6x6uB Wor5 from pyrococcus furiosus, taurine-bound (see paper)
38% identity, 26% coverage: 100:179/310 of query aligns to 52:125/167 of 6x6uB
- binding iron/sulfur cluster: C52 (= C100), V53 (≠ M101), C55 (= C103), P59 (≠ G107), C60 (= C108), C64 (= C112), P65 (= P113), L69 (≠ A117), C85 (= C133), I86 (= I134), T87 (≠ G135), C88 (= C136), G89 (= G137), C91 (= C139), C95 (= C143), P100 (= P148), C112 (= C160), D113 (≠ T161), L114 (= L162), C115 (= C163), P119 (= P173), C121 (= C175), C125 (= C179)
Sites not aligning to the query:
- binding phosphate ion: 10, 128, 130, 161, 162
- binding iron/sulfur cluster: 12, 13, 15, 16, 18, 22, 26, 36, 37, 39, 130, 133
Query Sequence
>BPHYT_RS32435 FitnessBrowser__BFirm:BPHYT_RS32435
MALQSLDIKRLSATTLPEPQVRVPVTGTVAKLIDVSKCIGCKACQTACMEWNDLRDEVGT
TTGIYDNPRDLSEHSWTVMRFSEYENTEGDLEWLIRKDGCMHCEDPGCLKACPSPGAIVQ
YTNGIVDFHEENCIGCGYCITGCPFNIPRISKQDNRAYKCTLCSDRVAVGQEPACVKTCP
TGAIMFGTKEDMKQQASDRIEDLKERGFQNAGLYDPAGVGGTHVMYVLHHADKATLYHGL
PQNPKISVMVALWKGLAKPLALAGIAFAALAGFFHYTRVGPNEVSEADEAEAQHEADEVR
RSREASNEAP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory