Comparing BPHYT_RS32970 FitnessBrowser__BFirm:BPHYT_RS32970 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4jbbA Crystal structure of glutathione s-transferase a6tby7(target efi- 507184) from klebsiella pneumoniae mgh 78578, gsh complex
56% identity, 95% coverage: 6:205/210 of query aligns to 4:206/208 of 4jbbA
P77544 Glutathione S-transferase YfcF; EC 2.5.1.18 from Escherichia coli (strain K12) (see paper)
51% identity, 98% coverage: 1:205/210 of query aligns to 1:208/214 of P77544
3bbyA Crystal structure of glutathione s-transferase (np_416804.1) from escherichia coli k12 at 1.85 a resolution
50% identity, 96% coverage: 5:205/210 of query aligns to 3:188/191 of 3bbyA
4isdA Crystal structure of glutathione transferase homolog from burkholderia gl bgr1, target efi-501803, with bound glutathione
50% identity, 96% coverage: 6:207/210 of query aligns to 5:185/187 of 4isdA
2v6kA Structure of maleyl pyruvate isomerase, a bacterial glutathione-s- transferase in zeta class, in complex with substrate analogue dicarboxyethyl glutathione (see paper)
35% identity, 46% coverage: 24:120/210 of query aligns to 19:115/214 of 2v6kA
Sites not aligning to the query:
2jl4A Holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class (see paper)
35% identity, 46% coverage: 24:120/210 of query aligns to 17:113/212 of 2jl4A
Sites not aligning to the query:
O86043 Maleylpyruvate isomerase; MPI; Naphthalene degradation protein L; EC 5.2.1.4 from Ralstonia sp. (see paper)
35% identity, 46% coverage: 24:120/210 of query aligns to 17:113/212 of O86043
Sites not aligning to the query:
Q64471 Glutathione S-transferase theta-1; GST class-theta-1; EC 2.5.1.18 from Mus musculus (Mouse) (see paper)
30% identity, 63% coverage: 6:138/210 of query aligns to 3:138/240 of Q64471
Sites not aligning to the query:
P30711 Glutathione S-transferase theta-1; GST class-theta-1; Glutathione transferase T1-1; EC 2.5.1.18 from Homo sapiens (Human) (see 2 papers)
34% identity, 50% coverage: 5:110/210 of query aligns to 2:106/240 of P30711
Sites not aligning to the query:
2c3qA Human glutathione-s-transferase t1-1 w234r mutant, complex with s- hexylglutathione (see paper)
34% identity, 50% coverage: 5:110/210 of query aligns to 1:105/239 of 2c3qA
Sites not aligning to the query:
7zvpA Crystal structure of poplar glutathione transferase u19 in complex with glutathione (see paper)
32% identity, 41% coverage: 14:100/210 of query aligns to 9:93/216 of 7zvpA
8a0rA Crystal structure of poplar glutathione transferase u20 in complex with pinocembrin (see paper)
31% identity, 42% coverage: 12:100/210 of query aligns to 6:92/215 of 8a0rA
Sites not aligning to the query:
8a0qA Crystal structure of poplar glutathione transferase u20 in complex with baicalein (see paper)
31% identity, 42% coverage: 12:100/210 of query aligns to 6:92/215 of 8a0qA
Sites not aligning to the query:
8a0oA Crystal structure of poplar glutathione transferase u20 in complex with galangin (see paper)
31% identity, 42% coverage: 12:100/210 of query aligns to 6:92/215 of 8a0oA
Sites not aligning to the query:
8a0iA Crystal structure of poplar glutathione transferase u20 in complex with glutathionylphenylacetophenone (see paper)
31% identity, 42% coverage: 12:100/210 of query aligns to 6:92/215 of 8a0iA
Sites not aligning to the query:
8a08A Crystal structure of poplar glutathione transferase u20 in complex with glutathione (see paper)
31% identity, 42% coverage: 12:100/210 of query aligns to 6:92/215 of 8a08A
8a0pA Crystal structure of poplar glutathione transferase u20 in complex with morin (see paper)
31% identity, 42% coverage: 12:100/210 of query aligns to 7:93/216 of 8a0pA
Sites not aligning to the query:
3qawA Crystal structure of a glutathione-s-transferase from antarctic clam laternula elliptica in a complex with glutathione (see paper)
28% identity, 41% coverage: 15:101/210 of query aligns to 10:96/219 of 3qawA
2cz2A Crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-1 crystal)
25% identity, 72% coverage: 14:165/210 of query aligns to 9:154/212 of 2cz2A
Q9WVL0 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Mus musculus (Mouse)
25% identity, 72% coverage: 14:165/210 of query aligns to 12:157/216 of Q9WVL0
>BPHYT_RS32970 FitnessBrowser__BFirm:BPHYT_RS32970
MFEGSLRLYADAQFASPYAMSVFVALQEKQLPFELFAVDLGTDANHEESYAAKSLTQRVP
TLTHGAFALSESSAITEYLDDTFAETLVYPQDRHLRARARQLQAWLRSDLMPIRQERSTE
VVFYKRQAPPFSAKAQLAVQKLYFAADRLLSNDASNLFGDWCIADTDLALMLNRLVMNGD
DVPAKLASYAAHQWERASVQQWVTLDRPRL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory