Comparing BPHYT_RS33445 FitnessBrowser__BFirm:BPHYT_RS33445 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1cjxA Crystal structure of pseudomonas fluorescens hppd (see paper)
40% identity, 94% coverage: 21:374/377 of query aligns to 3:343/352 of 1cjxA
7x8eA Crystal structure of pfhppd-y13287 complex
41% identity, 94% coverage: 21:374/377 of query aligns to 5:335/341 of 7x8eA
7xntA Crystal structure of pfhppd-y13161 complex
41% identity, 94% coverage: 21:374/377 of query aligns to 6:339/341 of 7xntA
7xntC Crystal structure of pfhppd-y13161 complex
40% identity, 93% coverage: 21:371/377 of query aligns to 5:320/320 of 7xntC
Q88JU3 3-dehydroshikimate dehydratase; DSD; EC 4.2.1.118 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
33% identity, 93% coverage: 27:376/377 of query aligns to 295:630/635 of Q88JU3
Sites not aligning to the query:
5hmqD Xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein
33% identity, 92% coverage: 27:373/377 of query aligns to 297:624/624 of 5hmqD
Sites not aligning to the query:
1t47A Structure of fe2-hppd bound to ntbc (see paper)
29% identity, 94% coverage: 21:374/377 of query aligns to 1:360/362 of 1t47A
7yvvA Acmp1, r-4-hydroxymandelate synthase
31% identity, 77% coverage: 84:374/377 of query aligns to 66:332/335 of 7yvvA
2r5vA Hydroxymandelate synthase crystal structure (see paper)
30% identity, 82% coverage: 65:373/377 of query aligns to 45:341/346 of 2r5vA
O52791 4-hydroxymandelate synthase; HMS; HmaS; 4-hydroxyphenylpyruvate dioxygenase II; EC 1.13.11.46 from Amycolatopsis orientalis (Nocardia orientalis) (see paper)
30% identity, 82% coverage: 65:373/377 of query aligns to 46:343/357 of O52791
Q02110 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; EC 1.13.11.27 from Sus scrofa (Pig) (see paper)
26% identity, 89% coverage: 39:374/377 of query aligns to 31:373/393 of Q02110
Sites not aligning to the query:
5ec3A Structural insight into the catalyitc mechanism of human 4- hydroxyphenylpyruvate dioxygenase
26% identity, 89% coverage: 39:374/377 of query aligns to 23:365/376 of 5ec3A
8im2A Crystal structure of human hppd complexed with ntbc (see paper)
26% identity, 89% coverage: 39:374/377 of query aligns to 25:367/374 of 8im2A
8im3A Crystal structure of human hppd complexed with compound a10 (see paper)
26% identity, 89% coverage: 39:374/377 of query aligns to 25:367/371 of 8im3A
3zgjB S221m v223f y359a mutant of 4-hydroxymandelate synthase from streptomyces coelicolor (see paper)
28% identity, 91% coverage: 33:374/377 of query aligns to 12:340/343 of 3zgjB
P32755 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; F Alloantigen; F protein; EC 1.13.11.27 from Rattus norvegicus (Rat) (see 2 papers)
26% identity, 90% coverage: 39:377/377 of query aligns to 31:376/393 of P32755
Sites not aligning to the query:
1sqiA Structural basis for inhibitor selectivity revealed by crystal structures of plant and mammalian 4-hydroxyphenylpyruvate dioxygenases (see paper)
26% identity, 87% coverage: 39:367/377 of query aligns to 24:343/343 of 1sqiA
1sqiB Structural basis for inhibitor selectivity revealed by crystal structures of plant and mammalian 4-hydroxyphenylpyruvate dioxygenases (see paper)
25% identity, 87% coverage: 39:367/377 of query aligns to 25:342/342 of 1sqiB
1sp8D 4-hydroxyphenylpyruvate dioxygenase (see paper)
29% identity, 72% coverage: 87:356/377 of query aligns to 97:354/393 of 1sp8D
7e0xA Crystal structure of arabidopsis thaliana hppd complexed with 4- hydroxyphenylacetic acid (see paper)
27% identity, 77% coverage: 67:356/377 of query aligns to 76:352/384 of 7e0xA
>BPHYT_RS33445 FitnessBrowser__BFirm:BPHYT_RS33445
MPSDLPTPDAALRAVSAPEHNPLGTAGLEFVEFAARDPQALGETFTKLGFKAIARHISKD
VTLYRQGEMQFLINAEPDSFAARYAEEYGAGICAIGIRVADAQRAFDRAIELGAWAFEGE
KIGTGELLIPAIQGIGDSHIYFVDRWRGRGGQRGGLGDISIFDIDFRPIEIDTAHADLSH
AGNGLVAVDHLTQTVGEGRMQEWLDFYRDLLNFREIHELHANWHVSAESRVMVSPCGAIR
VPLYEEGTSRTNLMHEYLPDHPGEGVQHIALATDDIFACVEQLLANGVEFVEPPPRYYDQ
LDARLPGHGLDIVRLERTRVLVDGEISADGVPLLFFQTFVRRRAGEIFFEIVQRQGHHGF
GEGNLSALAKAREQAGA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory