Comparing BPHYT_RS34225 FitnessBrowser__BFirm:BPHYT_RS34225 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7svqA Crystal structure of l-galactose dehydrogenase from spinacia oleracea in complex with NAD+ (see paper)
28% identity, 90% coverage: 11:321/346 of query aligns to 3:285/315 of 7svqA
7eziA Rice l-galactose dehydrogenase (apo form)
30% identity, 90% coverage: 11:321/346 of query aligns to 9:291/323 of 7eziA
7ezlA Rice l-galactose dehydrogenase (holo form)
30% identity, 90% coverage: 11:321/346 of query aligns to 4:286/318 of 7ezlA
1pz0A Structure of NADPH-dependent family 11 aldo-keto reductase akr11a(holo) (see paper)
26% identity, 89% coverage: 11:318/346 of query aligns to 1:291/311 of 1pz0A
P46336 Aldo-keto reductase IolS; AKR11A; Vegetative protein 147; VEG147; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
26% identity, 89% coverage: 11:318/346 of query aligns to 2:292/310 of P46336
P77256 NADH-specific methylglyoxal reductase; AKR11B2; EC 1.1.1.- from Escherichia coli (strain K12) (see paper)
25% identity, 92% coverage: 15:333/346 of query aligns to 6:319/326 of P77256
1ynqB Aldo-keto reductase akr11c1 from bacillus halodurans (holo form) (see paper)
27% identity, 90% coverage: 11:320/346 of query aligns to 3:272/298 of 1ynqB
1ynpB Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
27% identity, 90% coverage: 11:320/346 of query aligns to 3:272/298 of 1ynpB
Q3L181 Perakine reductase; EC 1.1.1.317 from Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum) (see paper)
25% identity, 90% coverage: 12:323/346 of query aligns to 3:297/337 of Q3L181
6ow0B Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
26% identity, 88% coverage: 13:318/346 of query aligns to 4:275/301 of 6ow0B
6ow0A Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
25% identity, 88% coverage: 13:318/346 of query aligns to 4:299/323 of 6ow0A
1ynpA Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
24% identity, 90% coverage: 11:320/346 of query aligns to 3:257/283 of 1ynpA
Sites not aligning to the query:
3v0sA Crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during NADPH binding (see paper)
24% identity, 90% coverage: 12:323/346 of query aligns to 3:265/287 of 3v0sA
6kiyA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor epalrestat (see paper)
24% identity, 95% coverage: 13:339/346 of query aligns to 5:273/275 of 6kiyA
6kikA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor tolrestat (see paper)
24% identity, 95% coverage: 13:339/346 of query aligns to 5:273/275 of 6kikA
5danA Crystal structure of a novel aldo keto reductase tm1743 from thermotoga maritima in complex with NADP+
24% identity, 95% coverage: 13:339/346 of query aligns to 4:272/274 of 5danA
1pz1A Structure of NADPH-dependent family 11 aldo-keto reductase akr11b(holo) (see paper)
25% identity, 85% coverage: 20:312/346 of query aligns to 11:287/333 of 1pz1A
P80874 Aldo-keto reductase YhdN; AKR11B; General stress protein 69; GSP69; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
25% identity, 85% coverage: 20:312/346 of query aligns to 11:287/331 of P80874
8hw0A The structure of akr6d1
24% identity, 89% coverage: 11:319/346 of query aligns to 2:301/329 of 8hw0A
Q9P7U2 Putative aryl-alcohol dehydrogenase C977.14c; EC 1.1.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
23% identity, 89% coverage: 15:323/346 of query aligns to 12:330/351 of Q9P7U2
>BPHYT_RS34225 FitnessBrowser__BFirm:BPHYT_RS34225
MTATIGSKIGQRRRIGRGPLQVTGLGLGTAPLGGLYRDLSDEEAHATIAAAWDAGVRYFD
TAPHYGNTKAEHRLGDALRRYPRADYVLSTKVGRRFVPRTTPFDDKEGWQNPLPFEAIYD
YTHDGILRSFEDSQQRLGIVDIDILLVHDIGRVTHGDNHPHYWRQLTEGGGFRALDALRS
SGAIKAVGLGVNEGAAILDAMAEFDIDCALLAGRYTLLEQTTLDDLLPACEKRGVSILLG
GAFNSGILARGVQGDLKFNYGEAPPEVIERVARLEAVCRTHGVPLAAAALQFPYAHPTVA
TVLTGARSADELRENAASFELPIPAALWFALREEGLLDSRAPAPED
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory