Comparing BPHYT_RS34470 FitnessBrowser__BFirm:BPHYT_RS34470 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ia4B Crystal structure of novel amino acid binding protein from shigella flexneri
59% identity, 96% coverage: 10:282/285 of query aligns to 1:275/278 of 2ia4B
2vhaA Debp (see paper)
58% identity, 95% coverage: 11:282/285 of query aligns to 3:274/276 of 2vhaA
8ovoA X-ray structure of the sf-iglusnfr-s72a in complex with l-aspartate
57% identity, 87% coverage: 11:257/285 of query aligns to 1:247/503 of 8ovoA
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
32% identity, 77% coverage: 35:253/285 of query aligns to 16:225/226 of 4zv1A
Sites not aligning to the query:
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
31% identity, 77% coverage: 35:253/285 of query aligns to 16:223/225 of 4zv2A
Sites not aligning to the query:
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
31% identity, 76% coverage: 36:253/285 of query aligns to 26:234/243 of 5eyfB
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
29% identity, 77% coverage: 35:253/285 of query aligns to 22:227/229 of 6svfA
Sites not aligning to the query:
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
28% identity, 84% coverage: 15:253/285 of query aligns to 2:228/229 of 5t0wA
2q2cA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
29% identity, 80% coverage: 25:253/285 of query aligns to 3:220/231 of 2q2cA
2pvuA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
29% identity, 80% coverage: 25:253/285 of query aligns to 7:224/235 of 2pvuA
2q2aA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
29% identity, 80% coverage: 25:253/285 of query aligns to 13:230/241 of 2q2aA
2yjpA Crystal structure of the solute receptors for l-cysteine of neisseria gonorrhoeae (see paper)
27% identity, 83% coverage: 15:251/285 of query aligns to 3:229/247 of 2yjpA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
27% identity, 77% coverage: 35:253/285 of query aligns to 13:222/224 of 4ymxA
Sites not aligning to the query:
6h2tA Glnh bound to glu, mycobacterium tuberculosis (see paper)
25% identity, 88% coverage: 8:259/285 of query aligns to 41:282/288 of 6h2tA
6h20A Glnh bound to asn, mycobacterium tuberculosis (see paper)
25% identity, 91% coverage: 2:259/285 of query aligns to 30:281/287 of 6h20A
6h1uA Glnh bound to asp, mycobacterium tuberculosis (see paper)
25% identity, 91% coverage: 2:259/285 of query aligns to 30:281/287 of 6h1uA
5owfA Structure of a lao-binding protein mutant with glutamine (see paper)
28% identity, 81% coverage: 23:253/285 of query aligns to 1:228/235 of 5owfA
1lstA Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand (see paper)
28% identity, 81% coverage: 23:253/285 of query aligns to 4:231/238 of 1lstA
1lahE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
28% identity, 81% coverage: 23:253/285 of query aligns to 4:231/238 of 1lahE
1lagE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
28% identity, 81% coverage: 23:253/285 of query aligns to 4:231/238 of 1lagE
>BPHYT_RS34470 FitnessBrowser__BFirm:BPHYT_RS34470
MSLPVIAADAAPTGTLKKIQDQHVVTIGYRDASIPFSYYDAQQKPIGYSIDIANLIIDRI
KAQLKQGDLQVRLIPITSQNRISLLQNGTIDFECTSTTNNAARAQQVDFSNSFFDIGTRL
LVRQNSGIHDFADLKGKTVVVGAGTTSEKSIRNMNVEKSMGMNIISAKDHSESFLMLSTG
RAKAMMMDDALLAGERAKTSRPEDYAIVGTPQSFEAYGCMLRKNDAQLKALMDAAIADAE
RSGVATAIYKKWFMAPIPPKGINLNFPMSTRMQTLFAHPNDKPAS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory