Comparing BWI76_RS00580 FitnessBrowser__Koxy:BWI76_RS00580 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4xckA Vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion. (see paper)
40% identity, 65% coverage: 101:361/403 of query aligns to 3:262/306 of 4xckA
Sites not aligning to the query:
P0A9J6 Ribokinase; RK; EC 2.7.1.15 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 65% coverage: 100:361/403 of query aligns to 5:265/309 of P0A9J6
Sites not aligning to the query:
1gqtB Activation of ribokinase by monovalent cations (see paper)
38% identity, 65% coverage: 100:361/403 of query aligns to 4:264/307 of 1gqtB
Sites not aligning to the query:
1rk2A E. Coli ribokinase complexed with ribose and adp, solved in space group p212121 (see paper)
38% identity, 65% coverage: 100:361/403 of query aligns to 2:262/305 of 1rk2A
Sites not aligning to the query:
6wk0B Crystal structure of human ribokinase in complex with amppcp and ribose
36% identity, 65% coverage: 102:362/403 of query aligns to 5:267/311 of 6wk0B
Sites not aligning to the query:
5c41A Crystal structure of human ribokinase in complex with amppcp in p21 spacegroup and with 4 protomers
36% identity, 65% coverage: 102:362/403 of query aligns to 5:267/317 of 5c41A
Sites not aligning to the query:
2fv7A Crystal structure of human ribokinase
36% identity, 65% coverage: 102:362/403 of query aligns to 4:266/308 of 2fv7A
Sites not aligning to the query:
5c3yA Structure of human ribokinase crystallized with amppnp
36% identity, 65% coverage: 102:362/403 of query aligns to 4:266/306 of 5c3yA
Sites not aligning to the query:
6wjzA Crystal structure of human ribokinase in complex with ampcp
36% identity, 65% coverage: 102:362/403 of query aligns to 5:267/315 of 6wjzA
Sites not aligning to the query:
Q9H477 Ribokinase; RK; EC 2.7.1.15 from Homo sapiens (Human)
36% identity, 64% coverage: 106:362/403 of query aligns to 22:280/322 of Q9H477
Sites not aligning to the query:
5byfA Crystal structure of human ribokinase in complex with amp
36% identity, 64% coverage: 106:362/403 of query aligns to 10:268/313 of 5byfA
Sites not aligning to the query:
6ilsB Structure of arabidopsis thaliana ribokinase complexed with ribose and atp (see paper)
34% identity, 73% coverage: 98:392/403 of query aligns to 1:301/313 of 6ilsB
A1A6H3 Ribokinase; AtRBSK; RK; EC 2.7.1.15 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 72% coverage: 102:392/403 of query aligns to 71:367/379 of A1A6H3
Sites not aligning to the query:
8cqxA Ribokinase from t.Sp mutant a92g
35% identity, 71% coverage: 102:387/403 of query aligns to 2:284/300 of 8cqxA
Sites not aligning to the query:
6a8cA Ribokinase from leishmania donovani with adp (see paper)
32% identity, 71% coverage: 102:386/403 of query aligns to 16:311/327 of 6a8cA
6a8bA Ribokinase from leishmania donovani with amppcp (see paper)
32% identity, 71% coverage: 102:386/403 of query aligns to 16:311/327 of 6a8bA
6a8aA Ribokinase from leishmania donovani with atp (see paper)
32% identity, 71% coverage: 102:386/403 of query aligns to 16:311/327 of 6a8aA
6znxC Ribokinase from thermus species
31% identity, 71% coverage: 102:387/403 of query aligns to 2:249/265 of 6znxC
3i3yD Crystal structure of ribokinase in complex with d-ribose from klebsiella pneumoniae
28% identity, 65% coverage: 101:360/403 of query aligns to 2:241/285 of 3i3yD
3ikhA Crystal structure of ribokinase in complex with atp and glycerol in the active site from klebsiella pneumoniae
28% identity, 65% coverage: 101:360/403 of query aligns to 3:242/286 of 3ikhA
Sites not aligning to the query:
>BWI76_RS00580 FitnessBrowser__Koxy:BWI76_RS00580
MFLEERRKSILRYLDEHERGYVNYFSAHFNVTKETIRSDLNTLAAMGLVQRCYGGAIISR
RSLQAELISETGDSFEVLLQPLNHRKSPGDERQKGKVMQGKVCVFGSFNVDIVAKVERFP
RGGESLMALGSSLGPGGKGANQATAASKAGAQVHFVAKVGKDQFSHLAADHLTRSAIHSY
TLYQSESEPTGNAIIYVSQENGENMIAIYSGANTTITYSEIQKIIPELSSSDVLLVQLEN
NFDATHSLIKIAHELGKQVILNPAPYSAEIIPSIPFVDVITPNETEASLLSGIDISDFDT
AKEAALRIARLGAKKVLITMGSRGALLLDNRQFSHIRAFPAVTVDTTGAGDAFNGALAAS
LAAGNSLVQAATWASAFASLAVELEGASNMPEFEQANARLRTL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory