Comparing BWI76_RS00680 FitnessBrowser__Koxy:BWI76_RS00680 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
P32171 L-Rhamnulokinase; RhaB; RhuK; ATP:L-rhamnulose phosphotransferase; L-rhamnulose 1-kinase; Rhamnulose kinase; EC 2.7.1.5 from Escherichia coli (strain K12) (see paper)
78% identity, 100% coverage: 1:488/488 of query aligns to 1:489/489 of P32171
Q1R415 Rhamnulokinase; Rhamnulose kinase; EC 2.7.1.5 from Escherichia coli (strain UTI89 / UPEC) (see paper)
78% identity, 100% coverage: 1:488/488 of query aligns to 1:489/489 of Q1R415
2uytA Structure of l-rhamnulose kinase in complex with adp and beta-l- rhamnulose. (see paper)
78% identity, 97% coverage: 2:476/488 of query aligns to 1:475/479 of 2uytA
2cglA Crystal structure of l-rhamnulose kinase from escherichia coli in complex with l-fructose, adp and a modeled atp gamma phosphate. (see paper)
78% identity, 97% coverage: 2:476/488 of query aligns to 1:475/479 of 2cglA
2cgjA Crystal structure of l-rhamnulose kinase from escherichia coli in complex with l-fructose and adp. (see paper)
78% identity, 97% coverage: 2:476/488 of query aligns to 1:475/479 of 2cgjA
3ll3B The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
28% identity, 24% coverage: 100:217/488 of query aligns to 95:212/490 of 3ll3B
Sites not aligning to the query:
3ll3A The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
28% identity, 24% coverage: 100:217/488 of query aligns to 96:213/492 of 3ll3A
Sites not aligning to the query:
2w40A Crystal structure of plasmodium falciparum glycerol kinase with bound glycerol (see paper)
25% identity, 26% coverage: 72:196/488 of query aligns to 72:202/501 of 2w40A
Sites not aligning to the query:
2w41B Crystal structure of plasmodium falciparum glycerol kinase with adp (see paper)
25% identity, 26% coverage: 72:196/488 of query aligns to 78:208/507 of 2w41B
Sites not aligning to the query:
5ya2A Crystal structure of lsrk-hpr complex with adp (see paper)
24% identity, 24% coverage: 100:218/488 of query aligns to 94:211/478 of 5ya2A
Sites not aligning to the query:
5ya1A Crystal structure of lsrk-hpr complex with atp (see paper)
24% identity, 24% coverage: 100:218/488 of query aligns to 94:211/478 of 5ya1A
Sites not aligning to the query:
>BWI76_RS00680 FitnessBrowser__Koxy:BWI76_RS00680
MSLRHCVAVDLGASSGRVMLASYQPGQQTLALREIHRFTNSLQKVDGFDCWDLDSLEGEI
RRGLEKVCEQGILIDSIGIDTWGVDYVLLDKRGQRVGLPVSYRDSRTQGLMRHAEAQLGR
AEIYRRSGIQFLPFNTLYQLRALVEQQPELVSQAAHALLIPDYFSFRLTGNMNWEYTNAT
TTQLVNINSDSWDEDLLNWSGAPREWFGTPTHPGNVIGHWICPQGNHIPVVAVASHDTAS
AVIASPLASKNAAYLSSGTWSLMGFESKIPCTSDAALRANITNEGGAEGRYRVLKNIMGL
WLLQRVLREQNVSDLPALIARTAALPACRFVIDCNDDRFINPDDMSAEIQAACRESGQPV
PDTDAELARCIFDSLALLYTRVLNELAALRGQPFSQLHIVGGGCQNELLNQLCADACGIT
VVAGPVEASTLGNIGIQLMTLDELNNVDEFRQVVRQNYALTTFTPNPENEIARFVAQFQP
QQNKELCA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory