Comparing BWI76_RS01515 FitnessBrowser__Koxy:BWI76_RS01515 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
P69791 PTS system N,N'-diacetylchitobiose-specific EIIA component; EIIA-Chb; EIII-Chb; IIIcel; N,N'-diacetylchitobiose-specific phosphotransferase enzyme IIA component from Escherichia coli (strain K12) (see paper)
47% identity, 96% coverage: 2:102/105 of query aligns to 15:115/116 of P69791
P23532 PTS system lactose-specific EIIA component; EIIA-Lac; EIII-Lac; Lactose-specific phosphotransferase enzyme IIA component from Lactococcus lactis subsp. lactis (Streptococcus lactis) (see 2 papers)
35% identity, 94% coverage: 2:100/105 of query aligns to 4:102/105 of P23532
P0A0D6 PTS system lactose-specific EIIA component; EIIA-Lac; EIII-Lac; Lactose-specific phosphotransferase enzyme IIA component from Staphylococcus aureus (see 2 papers)
33% identity, 94% coverage: 2:100/105 of query aligns to 4:102/103 of P0A0D6
>BWI76_RS01515 FitnessBrowser__Koxy:BWI76_RS01515
MEDLETIIMELLVNAGSARSSALTALQLARKGDFAAAEQAMTESHEFVKHAHKIQTQLIG
MDEGSGKLPVNLITVHSQDHLMNAMVIQDLATDMIELYRRIPLAQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory