SitesBLAST
Comparing BWI76_RS03640 FitnessBrowser__Koxy:BWI76_RS03640 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P76037 Putrescine importer PuuP from Escherichia coli (strain K12) (see paper)
32% identity, 95% coverage: 9:434/447 of query aligns to 15:444/461 of P76037
- Y110 (= Y104) mutation to X: The uptake activity is reduced to one-eighth of that of wild-type.
6f34A Crystal structure of a bacterial cationic amino acid transporter (cat) homologue bound to arginine. (see paper)
21% identity, 87% coverage: 43:432/447 of query aligns to 55:449/458 of 6f34A
- binding arginine: E115 (≠ D103), Y116 (= Y104), A119 (≠ V107), F228 (≠ L210), A229 (≠ S211), I231 (≠ L213), V314 (≠ A299)
- binding cholesterol: W201 (≠ G183), Y202 (≠ H184)
- binding : A178 (= A151), R179 (= R152), A186 (≠ I159), I187 (≠ A160), A190 (≠ V163), L194 (≠ V167), Q296 (≠ G279), V299 (≠ L282)
Sites not aligning to the query:
5oqtA Crystal structure of a bacterial cationic amino acid transporter (cat) homologue (see paper)
21% identity, 87% coverage: 43:432/447 of query aligns to 53:447/456 of 5oqtA
Sites not aligning to the query:
7cmiB The lat2-4f2hc complex in complex with leucine (see paper)
21% identity, 86% coverage: 47:432/447 of query aligns to 30:425/458 of 7cmiB
Sites not aligning to the query:
7cmhB The lat2-4f2hc complex in complex with tryptophan (see paper)
21% identity, 86% coverage: 47:432/447 of query aligns to 30:425/458 of 7cmhB
Sites not aligning to the query:
7b00A Human lat2-4f2hc complex in the apo-state (see paper)
21% identity, 86% coverage: 47:432/447 of query aligns to 30:425/457 of 7b00A
Q9UHI5 Large neutral amino acids transporter small subunit 2; L-type amino acid transporter 2; hLAT2; Solute carrier family 7 member 8 from Homo sapiens (Human) (see 3 papers)
21% identity, 86% coverage: 47:432/447 of query aligns to 70:465/535 of Q9UHI5
- Y93 (= Y67) mutation to A: Nearly complete reduction of glycine, L-alanine, and L-glutamine uptake. Minimal effect on the transport of L-isoleucine, L-histidine and L-tryptophan.
- N134 (≠ L110) Important for substrate specificity; binding ; mutation to Q: Reduces L-leucine uptake activity. Abolishes L-tryptophan uptake.; mutation to S: The substrate specificity changed dramatically reducing L-glutamine, glycine and L-alanine uptake activity thus mimicking the selectivity of SLC7A5.
- C154 (≠ V126) modified: Interchain (with C-210 in SLC3A2)
- W174 (≠ L141) mutation to A: Does not affect protein expression, plasma membrane localization, or L-alanine uptake.
- F243 (vs. gap) mutation to A: Abolishes leucine and tryptophan transport activities.
- G246 (≠ L213) Important for substrate specificity; binding ; mutation to S: Strong decrease in the uptake of large substrates L-tryptophan, L-glutamine, and L-histidine but increases the uptake of small neutral amino acids glycine and L-alanine.
- V302 (≠ D267) to I: found in a patient with age-related hearing loss; does not affect L-alanine transport activity. Decreases L-tyrosine transport activity
- N395 (≠ G369) binding ; mutation to Q: Strongly reduces L-leucine uptake activity. Strongly reduces L-tryptophan uptake activity.
- Y396 (≠ F370) mutation to A: Strongly reduces L-leucine uptake activity.
- T402 (≠ A376) to M: found in a patient with age-related hearing loss; strongly decreased L-alanine transport activity. Decreases L-tyrosine transport activity
- R418 (= R388) to C: found in a patient with age-related hearing loss; decreases L-alanine transport activity. Decreases L-tyrosine transport activity
- V460 (= V427) to E: found in a patient with age-related hearing loss; strongly decreases L-alanine transport activity. Decreases L-tyrosine transport activity. Decreases cell membrane localization
Sites not aligning to the query:
O34739 Serine/threonine exchanger SteT from Bacillus subtilis (strain 168) (see paper)
24% identity, 87% coverage: 1:389/447 of query aligns to 1:379/438 of O34739
- C94 (≠ A96) mutation to S: Retains 25% of the transport activity; when associated with S-141; S-168; S-291 and S-415.
- C141 (≠ S140) mutation to S: Retains 25% of the transport activity; when associated with S-94; S-168; S-291 and S-415.
- C168 (≠ V167) mutation to S: Retains 25% of the transport activity; when associated with S-94; S-141; S-291 and S-415.
- C291 (≠ I296) mutation to S: Retains 25% of the transport activity; when associated with S-94; S-141; S-168 and S-415.
Sites not aligning to the query:
- 415 C→S: Retains 25% of the transport activity; when associated with S-94; S-141; S-168 and S-291.
P24207 Phenylalanine-specific permease; Phenylalanine:H(+) symporter PheP from Escherichia coli (strain K12) (see 3 papers)
24% identity, 73% coverage: 4:329/447 of query aligns to 9:338/458 of P24207
- R26 (= R19) mutation R->G,S,Q: Strong decrease in phenylalanine transport activity.
- P54 (≠ G47) mutation to A: 50% of wild-type phenylalanine transport activity.; mutation to G: No change in phenylalanine transport activity.; mutation to L: 26% of wild-type phenylalanine transport activity.
- F87 (≠ V80) mutation to L: No effect on phenylalanine transport activity.
- F90 (≠ Y83) mutation to L: 65% of wild-type phenylalanine transport activity.
- Y92 (≠ Q85) mutation to L: 41% of wild-type phenylalanine transport activity.
- Y94 (≠ G87) mutation to L: 69% of wild-type phenylalanine transport activity.
- W95 (≠ I88) mutation to L: 10% of wild-type phenylalanine transport activity.
- F98 (≠ I91) mutation to L: No effect on phenylalanine transport activity.
- F101 (= F94) mutation to L: 38% of wild-type phenylalanine transport activity.
- W105 (= W98) mutation to L: 39% of wild-type phenylalanine transport activity.
- Y107 (≠ I100) mutation to L: No effect on phenylalanine transport activity.
- W108 (≠ L101) mutation to L: 71% of wild-type phenylalanine transport activity.
- F111 (≠ Y104) mutation to L: 60% of wild-type phenylalanine transport activity.; mutation to Y: Enables the transport of tryptophan to almost the same steady-state level as that of phenylalanine.
- E118 (≠ L111) mutation E->G,L,V,N: Loss of activity.
- K168 (≠ E161) mutation K->L,R: Strong decrease in phenylalanine transport activity.; mutation to N: Loss of activity.
- E226 (≠ D216) mutation E->A,Q,K,R,W: Loss of activity.
- R252 (vs. gap) mutation R->D,E,F,W,P: Loss of activity.
Sites not aligning to the query:
- 341 P→A: 5% of wild-type phenylalanine transport activity.; mutation P->G,Q,K,R: Loss of activity.; P→S: 3% of wild-type phenylalanine transport activity.; P→T: 17% of wild-type phenylalanine transport activity.
- 442 P→A: 46% of wild-type phenylalanine transport activity.; P→G: 52% of wild-type phenylalanine transport activity.; P→L: 43% of wild-type phenylalanine transport activity.
Q9QXW9 Large neutral amino acids transporter small subunit 2; L-type amino acid transporter 2; mLAT2; Solute carrier family 7 member 8 from Mus musculus (Mouse) (see paper)
22% identity, 86% coverage: 47:432/447 of query aligns to 69:464/531 of Q9QXW9
- Y130 (≠ V107) mutation to A: Increases T2 import. Increases T3 and enables T4 import. Does not affect L-leucine and L-phenylalanine uptake.
- N133 (≠ L110) mutation to S: Increases T2 import. Does not affect T3 import. Does not affect L-leucine and L-phenylalanine uptake. Increases the export of both L-leucine and L-phenylalanine.
- F242 (vs. gap) mutation to W: Increases T2 import. Does not affect T3 import. Does not affect L-leucine and L-phenylalanine uptake.
P30825 High affinity cationic amino acid transporter 1; CAT-1; CAT1; Ecotropic retroviral leukemia receptor homolog; Ecotropic retrovirus receptor homolog; Solute carrier family 7 member 1; System Y+ basic amino acid transporter from Homo sapiens (Human) (see paper)
24% identity, 86% coverage: 9:394/447 of query aligns to 25:443/629 of P30825
- N226 (≠ A180) modified: carbohydrate, N-linked (GlcNAc...) asparagine
P25737 Lysine-specific permease LysP; Lysine transporter LysP; Trigger transporter LysP from Escherichia coli (strain K12) (see 2 papers)
22% identity, 75% coverage: 51:385/447 of query aligns to 53:398/489 of P25737
- Y102 (≠ I100) mutation to L: Retains 4% of wild-type lysine uptake activity. Increases the capacity to inhibit CadC in the presence of lysine.
- W106 (≠ Y104) mutation to L: Retains 20% of wild-type lysine uptake activity. Increases the capacity to inhibit CadC in the presence of lysine.
- K163 (≠ E161) mutation to A: Retains 24% of wild-type lysine uptake activity. Increases the capacity to inhibit CadC in the presence of lysine.
- F216 (≠ L210) mutation to L: Retains 13% of wild-type lysine uptake activity. Increases the capacity to inhibit CadC in the presence of lysine.
- E222 (≠ D216) mutation to A: Abolishes lysine uptake. Strongly inhibits CadC.
- E230 (= E224) mutation to V: Abolishes lysine uptake. Shows significant less inhibition of CadC.
- D275 (≠ L257) Essential for the stimulus-dependent interaction with CadC; mutation to A: Retains 88% of wild-type lysine uptake activity, but can hardly inhibit CadC. Cannot interact with CadC; when associated with A-278.
- D278 (≠ G260) Essential for the stimulus-dependent interaction with CadC; mutation to A: Retains 88% of wild-type lysine uptake activity, but can hardly inhibit CadC. Cannot interact with CadC; when associated with A-275.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 438 E→A: Retains 14% of wild-type lysine uptake activity. Is unable to inhibit CadC.
- 443 D→A: Retains 11% of wild-type lysine uptake activity. Is unable to inhibit CadC.
- 446 D→A: Retains 13% of wild-type lysine uptake activity. Is unable to inhibit CadC.
P15993 Aromatic amino acid transport protein AroP; Aromatic amino acid:H(+) symporter AroP; General aromatic amino acid permease; General aromatic transport system from Escherichia coli (strain K12) (see paper)
25% identity, 86% coverage: 1:383/447 of query aligns to 2:377/457 of P15993
- Y103 (= Y104) Key residue for tryptophan transport; mutation to F: Decreases tryptophan transport to less than 50% of wild-type levels and reduces the ability of tryptophan to inhibit phenylalanine transport from 95 to 62%.
6irtB Human lat1-4f2hc complex bound with bch (see paper)
22% identity, 75% coverage: 64:398/447 of query aligns to 50:387/457 of 6irtB
Sites not aligning to the query:
7dsqB Overall structure of the lat1-4f2hc bound with 3,5-diiodo-l-tyrosine (see paper)
22% identity, 75% coverage: 64:398/447 of query aligns to 57:394/464 of 7dsqB
Sites not aligning to the query:
7dsnB Overall structure of the lat1-4f2hc bound with jx-119 (see paper)
22% identity, 75% coverage: 64:398/447 of query aligns to 57:394/464 of 7dsnB
- binding (2~{S})-2-azanyl-7-[[2-(1,3-benzoxazol-2-yl)phenyl]methoxy]-3,4-dihydro-1~{H}-naphthalene-2-carboxylic acid: I97 (≠ L106), I104 (= I113), F209 (≠ L210), A210 (≠ S211), G212 (≠ L213), I354 (≠ V362), N361 (≠ G369)
- binding cholesterol hemisuccinate: F109 (vs. gap), Y145 (≠ R145), K148 (≠ T148), V153 (≠ A153), Q326 (≠ R329)
Sites not aligning to the query:
7dslB Overall structure of the lat1-4f2hc bound with jx-078 (see paper)
22% identity, 75% coverage: 64:398/447 of query aligns to 57:394/464 of 7dslB
Sites not aligning to the query:
7dskB Overall structure of the lat1-4f2hc bound with jx-075 (see paper)
22% identity, 75% coverage: 64:398/447 of query aligns to 57:394/464 of 7dskB
- binding (2~{S})-2-azanyl-7-(naphthalen-1-ylmethoxy)-3,4-dihydro-1~{H}-naphthalene-2-carboxylic acid: I97 (≠ L106), S100 (= S109), S101 (≠ L110), F209 (≠ L210), G212 (≠ L213), Y216 (≠ G217), V353 (≠ L361), I354 (≠ V362), N361 (≠ G369)
- binding cholesterol hemisuccinate: K148 (≠ T148), A149 (≠ F149), V153 (≠ A153), F157 (≠ I157), H324 (= H327)
Sites not aligning to the query:
Q01650 Large neutral amino acids transporter small subunit 1; 4F2 light chain; 4F2 LC; 4F2LC; CD98 light chain; Integral membrane protein E16; E16; L-type amino acid transporter 1; hLAT1; Solute carrier family 7 member 5; y+ system cationic amino acid transporter from Homo sapiens (Human) (see 3 papers)
22% identity, 75% coverage: 64:398/447 of query aligns to 100:437/507 of Q01650
- Y117 (= Y81) mutation to A: Strongly decreased leucine transport activity.
- C164 (≠ V126) modified: Interchain (with C-210 in SLC3A2)
- D223 (≠ H184) to V: in dbSNP:rs17853937
- N230 (≠ L190) to K: in dbSNP:rs1060250
- A246 (= A204) mutation to V: Nearly abolishes leucine transport activity.
- F252 (≠ L210) mutation to A: Nearly abolishes leucine transport activity.
- W257 (≠ F215) mutation to A: Nearly abolishes leucine transport activity.
- N258 (≠ D216) mutation to A: Decreased leucine transport activity.; mutation to D: Nearly abolishes leucine transport activity.
- Y259 (≠ G217) mutation to A: Strongly decreased leucine transport activity.
- E303 (≠ L266) mutation to K: Decreased leucine transport activity.
- P375 (≠ V335) mutation to L: Nearly abolishes leucine transport activity.
Sites not aligning to the query:
- 483:507 mutation Missing: Nearly abolishes leucine transport activity.
7p9uB Cryo em structure of system xc- in complex with glutamate (see paper)
22% identity, 78% coverage: 44:390/447 of query aligns to 30:373/455 of 7p9uB
Query Sequence
>BWI76_RS03640 FitnessBrowser__Koxy:BWI76_RS03640
MSVEQFGYKQELHRALTFRDLLVYGMIFMVPIAPFGVFGYVWDGAQGMVALAYLIGMVAM
FFTAMSYWSMSRAFPVSGSVYAYAQRGIHPIVGFFAGWLILLDYILVPSLLYIVSAAALA
PMLPGVPGWLWIVGFIAINSLINLRGITFTARANNTILIAEIVVLSVFVVLGLIALYSGA
GAGHLTLDPLYNADKFSLPLVMGAVSIAVLSFLGFDGISTLSEETKDGVDTVGKASLGAL
MLVGSLFILQTWIAADLAQGMTFSSLDTAFYDTANLAGGGWLKYVTMWSTVISWGIANAL
VAQAAVSRILFAMARDKQLPQLLAKVHPRLKTPYVSTLFVALISLASGLWFYGDIDNLSR
LVNFGALMGFLVLHIAVINYYIIRQKSRNLVVHLLFPVVGLCIIGFVIYEMDAQAKVLGL
SWLAVGVVYYLLMRLVLKRNVELKLEG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory