Comparing BWI76_RS05440 FitnessBrowser__Koxy:BWI76_RS05440 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6rz0A Crystal structure of escherichia coli glyoxalase ii
76% identity, 100% coverage: 1:251/251 of query aligns to 1:251/251 of 6rz0A
2qedA Crystal structure of salmonella thyphimurium lt2 glyoxalase ii (see paper)
75% identity, 100% coverage: 1:251/251 of query aligns to 2:252/252 of 2qedA
Q8ZRM2 Hydroxyacylglutathione hydrolase; Glyoxalase II; Glx II; EC 3.1.2.6 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
75% identity, 100% coverage: 1:251/251 of query aligns to 1:251/251 of Q8ZRM2
8ewoA Crystal structure of putative glyoxylase ii from pseudomonas aeruginosa
43% identity, 98% coverage: 5:251/251 of query aligns to 7:259/259 of 8ewoA
Q9SID3 Hydroxyacylglutathione hydrolase 2, mitochondrial; Glyoxalase II; Glx II; EC 3.1.2.6 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
40% identity, 98% coverage: 6:251/251 of query aligns to 76:324/324 of Q9SID3
2q42A Ensemble refinement of the protein crystal structure of glyoxalase ii from arabidopsis thaliana gene at2g31350 (see paper)
40% identity, 100% coverage: 1:251/251 of query aligns to 1:254/254 of 2q42A
O24496 Hydroxyacylglutathione hydrolase cytoplasmic; Glyoxalase II; Glx II; EC 3.1.2.6 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 100% coverage: 1:251/251 of query aligns to 1:256/258 of O24496
Q16775 Hydroxyacylglutathione hydrolase, mitochondrial; Glyoxalase II; Glx II; EC 3.1.2.6 from Homo sapiens (Human) (see paper)
30% identity, 100% coverage: 1:251/251 of query aligns to 49:303/308 of Q16775
1qh5B Human glyoxalase ii with s-(n-hydroxy-n-bromophenylcarbamoyl) glutathione (see paper)
30% identity, 100% coverage: 1:251/251 of query aligns to 1:255/260 of 1qh5B
1qh5A Human glyoxalase ii with s-(n-hydroxy-n-bromophenylcarbamoyl) glutathione (see paper)
30% identity, 100% coverage: 1:251/251 of query aligns to 1:255/260 of 1qh5A
1qh3A Human glyoxalase ii with cacodylate and acetate ions present in the active site (see paper)
30% identity, 100% coverage: 1:251/251 of query aligns to 1:255/260 of 1qh3A
2p18A Crystal structure of the leishmania infantum glyoxalase ii (see paper)
29% identity, 91% coverage: 2:230/251 of query aligns to 14:270/283 of 2p18A
7ev5A Crystal structure of bleg-1 b3 metallo-beta-lactamase (see paper)
30% identity, 60% coverage: 15:165/251 of query aligns to 15:191/209 of 7ev5A
4ysbA Crystal structure of ethe1 from myxococcus xanthus (see paper)
29% identity, 62% coverage: 12:167/251 of query aligns to 13:172/225 of 4ysbA
Q9C8L4 Persulfide dioxygenase ETHE1 homolog, mitochondrial; Glyoxalase II; Glx II; Sulfur dioxygenase ETHE1; EC 1.13.11.18 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 46% coverage: 52:167/251 of query aligns to 109:234/294 of Q9C8L4
2gcuA X-ray structure of gene product from arabidopsis thaliana at1g53580 (see paper)
34% identity, 46% coverage: 52:167/251 of query aligns to 60:185/244 of 2gcuA
2xf4A Crystal structure of salmonella enterica serovar typhimurium ycbl (see paper)
28% identity, 65% coverage: 3:165/251 of query aligns to 5:192/210 of 2xf4A
7l0bA Crystal structure of hydroxyacyl glutathione hydrolase (glob) from staphylococcus aureus, apoenzyme (see paper)
27% identity, 56% coverage: 11:150/251 of query aligns to 13:169/202 of 7l0bA
Sites not aligning to the query:
2zwrB Crystal structure of ttha1623 from thermus thermophilus hb8 (see paper)
28% identity, 65% coverage: 4:165/251 of query aligns to 6:184/207 of 2zwrB
2zziA Crystal structure of ttha1623 in a di-iron-bound form (see paper)
28% identity, 65% coverage: 4:165/251 of query aligns to 4:182/198 of 2zziA
>BWI76_RS05440 FitnessBrowser__Koxy:BWI76_RS05440
MNLISIPAFQDNYIWVLSEDSGRCLIVDPGEAAPVLAAIEQNRWQPEAILLTHHHHDHVD
GVKKLREKFPAIAVYGPAETQDKGITHIVKDGESISVLGREFSIFATPGHTLGHICFFSA
PYLFCGDTMFSGGCGRLFEGNAEQMYQSFKKINALPDETLICCAHEYTLANMKFAMSILP
HDRDINDYYHKVNELRAKNQKTLPVILKNERRINLFLRTDDDDLIKEISKETNLQHSAQR
FAWLRSKKDDF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory