Comparing BWI76_RS05690 FitnessBrowser__Koxy:BWI76_RS05690 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
40% identity, 76% coverage: 57:270/282 of query aligns to 76:296/303 of 8skyB
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
40% identity, 76% coverage: 57:270/282 of query aligns to 77:297/303 of 8sutA
6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
40% identity, 70% coverage: 71:268/282 of query aligns to 69:269/279 of 6v77B
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
32% identity, 96% coverage: 1:270/282 of query aligns to 1:272/280 of 6j5xB
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
32% identity, 96% coverage: 1:270/282 of query aligns to 1:272/280 of 6j5xA
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
34% identity, 95% coverage: 2:268/282 of query aligns to 7:272/290 of 8gstC
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
34% identity, 95% coverage: 2:268/282 of query aligns to 7:272/290 of 8gsrA
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
33% identity, 97% coverage: 1:274/282 of query aligns to 2:274/277 of 6iymA
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
31% identity, 81% coverage: 42:270/282 of query aligns to 33:256/265 of 3r6oA
6sbiA X-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate (see paper)
35% identity, 62% coverage: 72:245/282 of query aligns to 12:191/216 of 6sbiA
6fogA X-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. (see paper)
34% identity, 62% coverage: 72:245/282 of query aligns to 13:192/218 of 6fogA
Q6P587 Acylpyruvase FAHD1, mitochondrial; Fumarylacetoacetate hydrolase domain-containing protein 1; FAH domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; YisK-like protein; EC 3.7.1.5; EC 4.1.1.112 from Homo sapiens (Human) (see 3 papers)
34% identity, 62% coverage: 72:245/282 of query aligns to 18:197/224 of Q6P587
1gttA Crystal structure of hpce (see paper)
35% identity, 64% coverage: 65:245/282 of query aligns to 215:392/421 of 1gttA
3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
33% identity, 72% coverage: 72:275/282 of query aligns to 62:248/252 of 3qdfA
4dbhA Crystal structure of cg1458 with inhibitor (see paper)
33% identity, 71% coverage: 71:270/282 of query aligns to 61:262/269 of 4dbhA
6j5yA Crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate (see paper)
30% identity, 62% coverage: 72:245/282 of query aligns to 24:208/233 of 6j5yA
6jvwB Crystal structure of maleylpyruvate hydrolase from sphingobium sp. Syk-6 in complex with manganese (ii) ion and pyruvate (see paper)
27% identity, 95% coverage: 1:268/282 of query aligns to 1:254/264 of 6jvwB
3v77A Crystal structure of a putative fumarylacetoacetate isomerase/hydrolase from oleispira antarctica (see paper)
32% identity, 61% coverage: 73:245/282 of query aligns to 17:197/224 of 3v77A
1nkqA Crystal structure of yeast ynq8, a fumarylacetoacetate hydrolase family protein
26% identity, 69% coverage: 72:266/282 of query aligns to 9:224/247 of 1nkqA
2q1dX 2-keto-3-deoxy-d-arabinonate dehydratase complexed with magnesium and 2,5-dioxopentanoate (see paper)
25% identity, 77% coverage: 57:274/282 of query aligns to 60:276/281 of 2q1dX
>BWI76_RS05690 FitnessBrowser__Koxy:BWI76_RS05690
MKLLSFRVNDKNKYGLATADGVIDLQALFPQYGSLLEFLPHLHLLDTLPPSAKKTHYSFN
EIAFLPVITEPKKIICAGVNYRDKNVVGNEKPANPVLFIRFADSQTGHLAPLLKPERSNE
FDYEGEMALVIGRGGRNIPEQEALQYVAGYSCYMDGSVRDWQHTCFTGGKNWPATGGFGP
WLVTADDIPDPQNLNITTRLNGQTVQQDNTGSMLYSIAELIAYISTFSALSPGDVILTGT
PGGIGKKRTPPLFMQPGDKVEVEIEQIGCLIHTVCSDAAVSR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory