SitesBLAST
Comparing BWI76_RS08490 FitnessBrowser__Koxy:BWI76_RS08490 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
1i9cA Glutamate mutase from clostridium cochlearium: complex with adenosylcobalamin and substrate (see paper)
57% identity, 91% coverage: 1:135/149 of query aligns to 1:135/137 of 1i9cA
- active site: V10 (= V10), D14 (= D14), H16 (= H16)
- binding cobalamin: S13 (≠ A13), D14 (= D14), C15 (= C15), H16 (= H16), A17 (= A17), G19 (= G19), L23 (= L23), S61 (= S61), L63 (≠ I63), Y64 (= Y64), G65 (= G65), G91 (= G91), G92 (= G92), N93 (= N93), V95 (= V95), V96 (= V96), T121 (≠ H121)
1ccwA Structure of the coenzyme b12 dependent enzyme glutamate mutase from clostridium cochlearium (see paper)
57% identity, 91% coverage: 1:135/149 of query aligns to 1:135/137 of 1ccwA
- active site: V10 (= V10), D14 (= D14), H16 (= H16)
- binding cyanocobalamin: D14 (= D14), C15 (= C15), H16 (= H16), A17 (= A17), G19 (= G19), I22 (≠ V22), S61 (= S61), L63 (≠ I63), Y64 (= Y64), G65 (= G65), G91 (= G91), G92 (= G92), N93 (= N93), V95 (= V95), Y117 (≠ F117), T121 (≠ H121), P123 (≠ L123)
1cb7A Glutamate mutase from clostridium cochlearium reconstituted with methyl-cobalamin (see paper)
57% identity, 91% coverage: 1:135/149 of query aligns to 1:135/137 of 1cb7A
- active site: V10 (= V10), D14 (= D14), H16 (= H16)
- binding co-methylcobalamin: D14 (= D14), C15 (= C15), H16 (= H16), A17 (= A17), G19 (= G19), L23 (= L23), S61 (= S61), L63 (≠ I63), Y64 (= Y64), G65 (= G65), G91 (= G91), G92 (= G92), N93 (= N93), V95 (= V95), V96 (= V96), T121 (≠ H121)
1id8A Nmr structure of glutamate mutase (b12-binding subunit) complexed with the vitamin b12 nucleotide (see paper)
60% identity, 83% coverage: 1:124/149 of query aligns to 1:124/137 of 1id8A
Q59268 2-methyleneglutarate mutase; Alpha-methyleneglutarate mutase; EC 5.4.99.4 from Eubacterium barkeri (Clostridium barkeri) (see paper)
26% identity, 91% coverage: 2:137/149 of query aligns to 471:612/614 of Q59268
- D483 (= D14) mutation to N: Activity reduced 2000-fold.
- H485 (= H16) mutation to Q: Loss of activity.
Sites not aligning to the query:
- 464 H→Q: No effect on activity.
Q99707 Methionine synthase; MS; 5-methyltetrahydrofolate--homocysteine methyltransferase; Cobalamin-dependent methionine synthase; Vitamin-B12 dependent methionine synthase; EC 2.1.1.13 from Homo sapiens (Human) (see 6 papers)
27% identity, 71% coverage: 3:108/149 of query aligns to 772:876/1265 of Q99707
Sites not aligning to the query:
- 61 natural variant: R -> K
- 255 C → Y: in dbSNP:rs1140598
- 382:384 binding
- 449 binding
- 470 binding
- 537 binding
- 579 binding
- 585 binding
- 591 binding
- 919 D → G: in dbSNP:rs1805087
- 963 D→E: Decreases binding to MTRR; when associated with N-1071.
- 1071 K→N: Decreases binding to MTRR; when associated with E-963.
3koyA Crystal structure of ornithine 4,5 aminomutase in complex with ornithine (aerobic) (see paper)
36% identity, 60% coverage: 6:95/149 of query aligns to 596:693/728 of 3koyA
- active site: K617 (≠ V26)
- binding cobalamin: E605 (≠ C15), H606 (= H16), S607 (≠ A17), V608 (= V18), V613 (= V22), S655 (= S61), I658 (≠ Y64), S659 (≠ G65), G689 (= G91), G690 (= G92), T691 (≠ N93)
Sites not aligning to the query:
- active site: 183, 218, 290
- binding cobalamin: 112, 483, 707, 710, 711
- binding (E)-N~5~-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-ornithine: 77, 105, 109, 110, 156, 158, 178, 183, 188, 218, 219, 290, 292
3koxA Crystal structure of ornithine 4,5 aminomutase in complex with 2,4- diaminobutyrate (anaerobic) (see paper)
36% identity, 60% coverage: 6:95/149 of query aligns to 596:693/728 of 3koxA
- active site: K617 (≠ V26)
- binding cobalamin: E605 (≠ C15), H606 (= H16), S607 (≠ A17), V608 (= V18), G609 (= G19), A654 (≠ V60), S655 (= S61), I657 (= I63), S659 (≠ G65), G689 (= G91), G690 (= G92), T691 (≠ N93)
Sites not aligning to the query:
- active site: 183, 218, 290
- binding cobalamin: 112, 483, 707, 708, 710, 711
- binding (2S)-2-amino-4-{[(1Z)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}butanoic acid: 77, 105, 108, 110, 156, 158, 183, 188, 218, 219, 290
3kowB Crystal structure of ornithine 4,5 aminomutase backsoaked complex (see paper)
36% identity, 60% coverage: 6:95/149 of query aligns to 596:693/728 of 3kowB
Sites not aligning to the query:
- active site: 183, 218, 290
- binding cobalamin: 707, 711
- binding pyridoxal-5'-phosphate: 105, 110, 156, 158, 178, 183, 188, 218, 219
E3PY95 D-ornithine 4,5-aminomutase subunit beta; D-ornithine aminomutase E component; OAM-E; EC 5.4.3.5 from Acetoanaerobium sticklandii (strain ATCC 12662 / DSM 519 / JCM 1433 / CCUG 9281 / NCIMB 10654 / HF) (Clostridium sticklandii) (see 2 papers)
36% identity, 60% coverage: 6:95/149 of query aligns to 605:702/740 of E3PY95
- EHS 614:616 (≠ CHA 15:17) binding
- H615 (= H16) binding axial binding residue; mutation to G: Loss of corrinoid-binding ability.
- K626 (≠ V26) modified: N6-(pyridoxal phosphate)lysine
- STIISH 664:669 (≠ SSIYGH 61:66) binding
Sites not aligning to the query:
3ivaA Structure of the b12-dependent methionine synthase (meth) c-teminal half with adohcy bound (see paper)
25% identity, 69% coverage: 6:108/149 of query aligns to 99:200/576 of 3ivaA
- active site: D107 (= D14), H109 (= H16), S160 (≠ D68)
- binding cobalamin: H109 (= H16), G112 (= G19), V116 (≠ L23), G152 (≠ V59), L153 (≠ V60), S154 (= S61), L156 (≠ I63), I157 (≠ Y64), T158 (≠ G65), G183 (= G91), G184 (= G92)
Sites not aligning to the query:
- binding cobalamin: 208, 209, 303, 443, 486, 488, 489, 495, 520, 521, 524, 527, 528
- binding s-adenosyl-l-homocysteine: 447, 484, 485, 489, 491, 539
3bulA E. Coli i690c/g743c meth c-terminal fragment (649-1227) (see paper)
25% identity, 69% coverage: 6:108/149 of query aligns to 99:200/577 of 3bulA
- active site: D107 (= D14), H109 (= H16), S160 (≠ D68)
- binding cobalamin: H109 (= H16), V116 (≠ L23), G152 (≠ V59), L153 (≠ V60), S154 (= S61), L156 (≠ I63), I157 (≠ Y64), T158 (≠ G65), G183 (= G91), G184 (= G92)
Sites not aligning to the query:
- binding cobalamin: 208, 209, 210, 213, 302, 443, 486, 487, 488, 489, 495, 498, 521, 524, 527, 528
P13009 Methionine synthase; 5-methyltetrahydrofolate--homocysteine methyltransferase; Methionine synthase, vitamin-B12-dependent; MS; EC 2.1.1.13 from Escherichia coli (strain K12) (see 5 papers)
25% identity, 69% coverage: 6:108/149 of query aligns to 749:850/1227 of P13009
- GDVHD 756:760 (≠ ADCHA 13:17) binding
- D757 (= D14) mutation to E: Decreases activity by about 70%.; mutation to N: Decreases activity by about 45%.
- H759 (= H16) binding axial binding residue; mutation to G: Loss of catalytic activity.
- S804 (= S61) binding
- T808 (≠ G65) binding
- S810 (≠ D68) mutation to A: Decreases activity by about 40%.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 247 binding
- 310 binding ; mutation C->A,S: Loss of zinc binding. Loss of catalytic activity.
- 311 binding ; mutation C->A,S: Loss of zinc binding. Loss of catalytic activity.
- 694 binding
- 860 binding
- 946 binding
- 1134 binding
- 1189:1190 binding
1bmtA How a protein binds b12: a 3.O angstrom x-ray structure of the b12- binding domains of methionine synthase (see paper)
25% identity, 69% coverage: 6:108/149 of query aligns to 99:200/246 of 1bmtA
- active site: D107 (= D14), H109 (= H16), S160 (≠ D68)
- binding co-methylcobalamin: D107 (= D14), V108 (≠ C15), H109 (= H16), D110 (≠ A17), I111 (≠ V18), I115 (≠ V22), G152 (≠ V59), L153 (≠ V60), S154 (= S61), L156 (≠ I63), I157 (≠ Y64), T158 (≠ G65), G183 (= G91), G184 (= G92), A185 (≠ N93)
Sites not aligning to the query:
Query Sequence
>BWI76_RS08490 FitnessBrowser__Koxy:BWI76_RS08490
MKKSTLVIGVIGADCHAVGNKVLDRVFTAHDFRVINLGVMVSQDEYIDAAIETGADAIVV
SSIYGHGDIDCLGLRERCIERGIGDILLYVGGNLVVGKHDFADVEAKFKEMGFNRVFAPS
HDLEDVCQLMANDINQRHGVEQQCLEEAI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory