SitesBLAST
Comparing BWI76_RS10220 FitnessBrowser__Koxy:BWI76_RS10220 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4n54A Crystal structure of scyllo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD(h) and scyllo-inositol
28% identity, 98% coverage: 7:335/335 of query aligns to 3:338/340 of 4n54A
- active site: K96 (= K100), H183 (= H180)
- binding (1r,2r,3r,4r,5r,6r)-cyclohexane-1,2,3,4,5,6-hexol: R12 (= R16), K96 (= K100), D156 (= D159), D179 (≠ E176), M180 (≠ T177), H183 (= H180), R238 (≠ F236), Y244 (= Y242)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V8 (≠ I12), G9 (= G13), L10 (≠ A14), G11 (= G15), R12 (= R16), L13 (≠ M17), S35 (≠ D39), V36 (≠ P40), E40 (≠ A44), S73 (= S77), P74 (= P78), F77 (≠ T81), H78 (= H82), E95 (= E99), K96 (= K100), M125 (≠ N128), F167 (≠ H170), F284 (≠ D281)
3ceaA Crystal structure of myo-inositol 2-dehydrogenase (np_786804.1) from lactobacillus plantarum at 2.40 a resolution
29% identity, 98% coverage: 7:333/335 of query aligns to 5:334/342 of 3ceaA
- active site: K98 (= K100), H185 (= H180)
- binding nicotinamide-adenine-dinucleotide: G11 (= G13), G13 (= G15), R14 (= R16), L15 (≠ M17), L38 (≠ P40), Q42 (≠ A44), V74 (≠ A76), A75 (≠ S77), P76 (= P78), T77 (≠ A79), F79 (≠ T81), H80 (= H82), M83 (≠ L85), E97 (= E99), K98 (= K100), M127 (≠ N128), F169 (≠ H170), H185 (= H180), F286 (≠ D281)
3ec7A Crystal structure of putative dehydrogenase from salmonella typhimurium lt2
31% identity, 96% coverage: 7:326/335 of query aligns to 3:317/336 of 3ec7A
- active site: K97 (= K100), H176 (= H180)
- binding nicotinamide-adenine-dinucleotide: G11 (= G15), M12 (≠ R16), I13 (≠ M17), D35 (= D39), I36 (≠ P40), R40 (≠ A44), T73 (≠ A76), A74 (≠ S77), S75 (≠ P78), N76 (≠ A79), H79 (= H82), E96 (= E99), K97 (= K100), M126 (≠ N128), W271 (≠ T277), Y279 (= Y289)
3nt5A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor and product inosose (see paper)
30% identity, 98% coverage: 7:335/335 of query aligns to 3:327/337 of 3nt5A
- active site: K97 (= K100), H176 (= H180)
- binding (2R,3S,4s,5R,6S)-2,3,4,5,6-pentahydroxycyclohexanone: K97 (= K100), H155 (≠ T157), H176 (= H180), Y235 (= Y242)
- binding nicotinamide-adenine-dinucleotide: G9 (= G13), G11 (= G15), A12 (≠ R16), I13 (≠ M17), D35 (= D39), V36 (≠ P40), S74 (= S77), W75 (≠ P78), G76 (≠ A79), E96 (= E99), K97 (= K100), Y280 (= Y289)
3nt4A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor nadh and inositol (see paper)
30% identity, 98% coverage: 7:335/335 of query aligns to 3:327/337 of 3nt4A
- active site: K97 (= K100), H176 (= H180)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: H155 (≠ T157), H176 (= H180), Y235 (= Y242), W272 (≠ T277)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G15), A12 (≠ R16), I13 (≠ M17), D35 (= D39), V36 (≠ P40), S74 (= S77), W75 (≠ P78), G76 (≠ A79), E96 (= E99), K97 (= K100), H176 (= H180)
3nt2B Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
30% identity, 98% coverage: 7:335/335 of query aligns to 3:327/337 of 3nt2B
- active site: K97 (= K100), H176 (= H180)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G13), G11 (= G15), A12 (≠ R16), D35 (= D39), V36 (≠ P40), S74 (= S77), W75 (≠ P78), A78 (≠ T81), K97 (= K100), W272 (≠ T277), Y280 (= Y289)
3nt2A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
30% identity, 98% coverage: 7:335/335 of query aligns to 3:327/337 of 3nt2A
- active site: K97 (= K100), H176 (= H180)
- binding nicotinamide-adenine-dinucleotide: G9 (= G13), G11 (= G15), A12 (≠ R16), I13 (≠ M17), D35 (= D39), V36 (≠ P40), S74 (= S77), W75 (≠ P78), G76 (≠ A79), A78 (≠ T81), H79 (= H82), E96 (= E99), K97 (= K100), H176 (= H180), Y280 (= Y289)
4l8vA Crystal structure of a12k/d35s mutant myo-inositol dehydrogenase from bacillus subtilis with bound cofactor NADP (see paper)
29% identity, 98% coverage: 7:335/335 of query aligns to 3:327/337 of 4l8vA
- active site: K97 (= K100), H176 (= H180)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K12 (≠ R16), I13 (≠ M17), S74 (= S77), W75 (≠ P78), H79 (= H82), E96 (= E99), K97 (= K100), M126 (≠ N128), W272 (≠ T277), Y280 (= Y289)
4mjlD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD and d-chiro-inositol
33% identity, 90% coverage: 6:306/335 of query aligns to 2:299/339 of 4mjlD
- active site: K97 (= K100)
- binding (1r,2r,3s,4s,5s,6s)-cyclohexane-1,2,3,4,5,6-hexol: K97 (= K100), H155 (≠ T157), N157 (≠ D159), D172 (≠ E176), T173 (= T177), H176 (= H180), Y236 (= Y242)
- binding nicotinamide-adenine-dinucleotide: G11 (= G15), A12 (≠ R16), M13 (= M17), D35 (= D39), I36 (≠ V41), V73 (≠ A76), S74 (= S77), H79 (= H82), E96 (= E99), K97 (= K100), M126 (≠ N128), D172 (≠ E176), W274 (≠ T277), Y282 (= Y289)
4mioD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD(h) and myo-inositol
33% identity, 90% coverage: 6:306/335 of query aligns to 2:299/339 of 4mioD
- active site: K97 (= K100)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: K97 (= K100), H155 (≠ T157), N157 (≠ D159), D172 (≠ E176), T173 (= T177), H176 (= H180), Y236 (= Y242)
- binding 1,4-dihydronicotinamide adenine dinucleotide: A12 (≠ R16), M13 (= M17), D35 (= D39), I36 (≠ V41), S74 (= S77), A78 (≠ T81), H79 (= H82), E96 (= E99), K97 (= K100), M126 (≠ N128), D172 (≠ E176), W274 (≠ T277), Y282 (= Y289)
4mioA Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD(h) and myo-inositol
33% identity, 90% coverage: 6:306/335 of query aligns to 2:299/339 of 4mioA
- active site: K97 (= K100)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G15), A12 (≠ R16), M13 (= M17), D35 (= D39), I36 (≠ V41), S74 (= S77), F75 (≠ P78), H79 (= H82), E96 (= E99), K97 (= K100), W274 (≠ T277), Y282 (= Y289)
4minA Crystal structure of myo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD
33% identity, 90% coverage: 6:306/335 of query aligns to 2:299/339 of 4minA
- active site: K97 (= K100)
- binding nicotinamide-adenine-dinucleotide: G11 (= G15), A12 (≠ R16), M13 (= M17), D35 (= D39), I36 (≠ V41), V73 (≠ A76), S74 (= S77), F75 (≠ P78), H79 (= H82), E96 (= E99), K97 (= K100), Y282 (= Y289)
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
28% identity, 98% coverage: 8:335/335 of query aligns to 3:329/333 of Q2I8V6
- AS---TI 9:12 (≠ AGRMGTF 14:20) binding
- S10 (≠ G15) mutation to G: Almost no effect.
- A13 (≠ H21) mutation to G: Can use NAD as cosubstrate as well as NADP.
- S33 (≠ D39) mutation to D: No activity.
- ST 33:34 (≠ DP 39:40) binding
- R38 (≠ A44) binding
- TTNELH 71:76 (≠ SPARTH 77:82) binding
- EK 93:94 (= EK 99:100) binding
- K94 (= K100) mutation to G: Less than 1% remaining activity.
- N120 (≠ G126) binding
- WR 162:163 (≠ LG 162:163) binding
- D176 (≠ E176) mutation to A: Less than 1% remaining activity.
- H180 (= H180) mutation to A: Less than 2% remaining activity.
- G206 (≠ K210) mutation to I: No effect.
- Y283 (= Y289) binding
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
28% identity, 98% coverage: 8:335/335 of query aligns to 2:328/332 of 2glxA
- active site: K93 (= K100), H179 (= H180)
- binding acetate ion: K93 (= K100), H179 (= H180)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G13), A8 (= A14), S9 (≠ G15), T10 (= T19), I11 (≠ F20), S32 (≠ D39), T33 (≠ P40), R37 (≠ A44), S69 (≠ A76), T70 (≠ S77), N72 (≠ A79), H75 (= H82), E92 (= E99), K93 (= K100), H121 (≠ N128), W161 (≠ L162), R162 (≠ G163), Y282 (= Y289)
6jw6A The crystal structure of kand2 in complex with NAD (see paper)
30% identity, 75% coverage: 7:256/335 of query aligns to 2:250/341 of 6jw6A
- binding nicotinamide-adenine-dinucleotide: G10 (= G15), F11 (≠ R16), M12 (= M17), D33 (= D39), L34 (≠ P40), T70 (≠ A76), T71 (≠ S77), P72 (= P78), N73 (≠ A79), L75 (≠ T81), H76 (= H82), Q79 (≠ L85), E93 (= E99), K94 (= K100), N122 (= N128), W161 (= W171), H179 (= H180)
Sites not aligning to the query:
6jw8A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin b (see paper)
30% identity, 75% coverage: 7:256/335 of query aligns to 2:250/342 of 6jw8A
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: F11 (≠ R16), F152 (≠ T157), N154 (≠ D159), D175 (≠ E176), L176 (≠ T177), H179 (= H180), E236 (≠ Y242)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G10 (= G15), F11 (≠ R16), M12 (= M17), D33 (= D39), L34 (≠ P40), T70 (≠ A76), T71 (≠ S77), P72 (= P78), N73 (≠ A79), L75 (≠ T81), H76 (= H82), Q79 (≠ L85), E93 (= E99), K94 (= K100), N122 (= N128), W161 (= W171), H179 (= H180)
Sites not aligning to the query:
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: 271
- binding 1,4-dihydronicotinamide adenine dinucleotide: 290
6jw7A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin a (see paper)
30% identity, 75% coverage: 7:256/335 of query aligns to 2:250/342 of 6jw7A
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: F11 (≠ R16), N154 (≠ D159), D175 (≠ E176), H179 (= H180), E236 (≠ Y242)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G8 (= G13), G10 (= G15), F11 (≠ R16), M12 (= M17), D33 (= D39), L34 (≠ P40), T70 (≠ A76), T71 (≠ S77), P72 (= P78), N73 (≠ A79), L75 (≠ T81), H76 (= H82), Q79 (≠ L85), E93 (= E99), K94 (= K100), N122 (= N128), W161 (= W171)
Sites not aligning to the query:
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: 271
- binding 1,4-dihydronicotinamide adenine dinucleotide: 290
7x2yA Crystal structure of cis-4,5-dihydrodiol phthalate dehydrogenase in complex with NAD+ and 3-hydroxybenzoate (see paper)
29% identity, 98% coverage: 7:335/335 of query aligns to 4:341/342 of 7x2yA
- binding 3-hydroxybenzoic acid: H122 (≠ F127), Q173 (≠ T177), H176 (= H180), E242 (= E247), M243 (≠ V248), R295 (≠ A291)
- binding nicotinamide-adenine-dinucleotide: G10 (= G13), G12 (= G15), R13 (= R16), A14 (≠ M17), D35 (= D39), P36 (= P40), R37 (≠ V41), A71 (= A76), S72 (= S77), P73 (= P78), F76 (≠ T81), Q80 (≠ L85), E94 (= E99), K95 (= K100), P96 (= P101), R161 (vs. gap), P163 (= P167), E164 (≠ I168)
8qc8D Crystal structure of NAD-dependent glycoside hydrolase from flavobacterium sp. (Strain k172) in complex with co-factor NAD+ (see paper)
31% identity, 69% coverage: 7:238/335 of query aligns to 2:236/339 of 8qc8D
- binding nicotinamide-adenine-dinucleotide: G10 (= G15), H11 (≠ R16), M12 (= M17), D33 (= D39), P34 (= P40), T35 (≠ V41), S38 (≠ A44), A71 (= A76), S72 (= S77), P73 (= P78), N74 (≠ A79), H77 (= H82), E96 (= E99), K97 (= K100), E125 (≠ N128), K162 (≠ D164), V163 (≠ I168), W166 (= W171)
4koaA Crystal structure analysis of 1,5-anhydro-d-fructose reductase from sinorhizobium meliloti (see paper)
27% identity, 99% coverage: 6:335/335 of query aligns to 1:329/333 of 4koaA
- active site: K94 (= K100), H180 (= H180)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G13), A9 (= A14), S10 (≠ G15), T11 (= T19), I12 (≠ F20), S33 (≠ D39), S34 (≠ P40), R38 (≠ A44), T71 (≠ S77), N73 (≠ A79), H76 (= H82), K94 (= K100), Q160 (vs. gap)
Query Sequence
>BWI76_RS10220 FitnessBrowser__Koxy:BWI76_RS10220
MSVKNVVRVGLIGAGRMGTFHGESVAQRIPGATLVAVADPVPGAAEELSARLGAKKSYTD
PQELLNDPEIDAVVIASPARTHAELVVAAAKAGKAIFCEKPMAVTLEDADKAINAAKKAG
VALQVGFNRRFVSGFSAAYEEIKAGKIGVPQLLRSTTRDPGLGDPTPIPHWTIFLETLIH
DFDILLHLNPGAKPTRVYAVADALVRPDFKDRGLLDTAVVNICFDNGAFATAEANFQAVY
GYDVRGEVFGSKGMLQAGNINVNNCVRYTADGISIDTARRDTDLLHDAYVAEVTDFVRCV
ATGDTPKATGEDARNALEVALACIASVQQSQPIKL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory