SitesBLAST
Comparing BWI76_RS11495 FitnessBrowser__Koxy:BWI76_RS11495 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6ciaA Crystal structure of aldo-keto reductase from klebsiella pneumoniae in complex with NADPH.
76% identity, 100% coverage: 1:284/284 of query aligns to 1:284/284 of 6ciaA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G20 (= G20), T21 (= T21), W22 (= W22), D50 (= D50), Y55 (= Y55), H113 (= H113), N143 (= N143), Q165 (= Q165), Y193 (= Y193), C194 (= C194), P195 (= P195), L196 (= L196), Q198 (= Q198), A199 (= A199), A224 (= A224), I240 (= I240), P241 (= P241), K242 (= K242), A243 (= A243), A244 (≠ S244), S245 (= S245), H248 (= H248), N252 (= N252)
4wghA Crystal structure of aldo/keto reductase from klebsiella pneumoniae in complex with NADP and acetate at 1.8 a resolution
76% identity, 99% coverage: 3:284/284 of query aligns to 2:283/283 of 4wghA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G20), T20 (= T21), W21 (= W22), D49 (= D50), Y54 (= Y55), N142 (= N143), Q164 (= Q165), Y192 (= Y193), C193 (= C194), P194 (= P195), L195 (= L196), Q197 (= Q198), A198 (= A199), R200 (= R201), A223 (= A224), I239 (= I240), P240 (= P241), K241 (= K242), A242 (= A243), A243 (≠ S244), S244 (= S245), H247 (= H248), N251 (= N252)
5c7hA Crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 in complex with NADPH
52% identity, 99% coverage: 5:284/284 of query aligns to 7:281/281 of 5c7hA
- active site: D52 (= D50), Y57 (= Y55), K82 (= K80), H115 (= H113)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G22 (= G20), T23 (= T21), W24 (= W22), D52 (= D50), Y57 (= Y55), H115 (= H113), Q167 (= Q165), Y195 (= Y193), S196 (≠ C194), P197 (= P195), L198 (= L196), E200 (≠ Q198), L204 (= L202), A221 (= A224), I237 (= I240), P238 (= P241), K239 (= K242), T240 (≠ A243), R245 (≠ H248), E248 (≠ Q251), N249 (= N252), I281 (≠ V284)
4pmjA Crystal structure of a putative oxidoreductase from sinorhizobium meliloti 1021 in complex with NADP
52% identity, 99% coverage: 5:284/284 of query aligns to 7:281/281 of 4pmjA
- active site: D52 (= D50), Y57 (= Y55), K82 (= K80), H115 (= H113)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G22 (= G20), T23 (= T21), W24 (= W22), D52 (= D50), H115 (= H113), Q167 (= Q165), Y195 (= Y193), S196 (≠ C194), P197 (= P195), L198 (= L196), E200 (≠ Q198), L204 (= L202), A221 (= A224), I237 (= I240), P238 (= P241), K239 (= K242), T240 (≠ A243), G241 (≠ S244), R245 (≠ H248), E248 (≠ Q251), N249 (= N252)
6kiyA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor epalrestat (see paper)
39% identity, 93% coverage: 7:269/284 of query aligns to 9:272/275 of 6kiyA
- binding {5-[(2E)-2-methyl-3-phenylprop-2-en-1-ylidene]-4-oxo-2-thioxo-1,3-thiazolidin-3-yl}acetic acid: W22 (= W22), Y59 (= Y55), W87 (≠ Y82), H118 (= H113), R204 (≠ N204)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G20), T21 (= T21), W22 (= W22), Y59 (= Y55), H118 (= H113), N149 (= N143), Q170 (= Q165), Y199 (= Y193), S200 (≠ C194), P201 (= P195), L202 (= L196), R204 (≠ N204), T205 (≠ G205), Y227 (≠ A224), I243 (= I240), P244 (= P241), K245 (= K242), G247 (≠ S244), R248 (≠ S245), H251 (= H248), E254 (≠ Q251), N255 (= N252)
6kikA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor tolrestat (see paper)
39% identity, 93% coverage: 7:269/284 of query aligns to 9:272/275 of 6kikA
5danA Crystal structure of a novel aldo keto reductase tm1743 from thermotoga maritima in complex with NADP+
39% identity, 93% coverage: 7:269/284 of query aligns to 8:271/274 of 5danA
- active site: D53 (= D50), Y58 (= Y55), K84 (= K80), H117 (= H113)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G20), T20 (= T21), W21 (= W22), D53 (= D50), Y58 (= Y55), H117 (= H113), Q169 (= Q165), Y198 (= Y193), S199 (≠ C194), P200 (= P195), L201 (= L196), R203 (≠ N204), Y226 (≠ A224), I242 (= I240), P243 (= P241), K244 (= K242), G246 (≠ S244), R247 (≠ S245), H250 (= H248), E253 (≠ Q251), N254 (= N252)
3v0sA Crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during NADPH binding (see paper)
28% identity, 92% coverage: 20:280/284 of query aligns to 17:285/287 of 3v0sA
- active site: D45 (= D50), Y50 (= Y55), G87 (= G88), H119 (= H113)
- binding 2'-monophosphoadenosine-5'-diphosphate: S198 (≠ C194), P199 (= P195), I200 (≠ L196), G201 (≠ A197), L204 (≠ G200), P246 (= P241), G247 (≠ K242), T248 (≠ A243), T249 (≠ S244), N253 (≠ H248), N256 (≠ Q251), N257 (= N252)
4fziA Crystal structure of prostaglandin f synthase from trypanosoma cruzi (see paper)
30% identity, 90% coverage: 14:270/284 of query aligns to 12:258/277 of 4fziA
4gieA Crystal structure of prostaglandin f synthase from trypanosoma cruzi bound to NADP (see paper)
30% identity, 90% coverage: 14:270/284 of query aligns to 23:269/288 of 4gieA
- active site: D55 (= D50), Y60 (= Y55), K85 (= K80), H118 (= H113)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G29 (= G20), W31 (= W22), D55 (= D50), Y60 (= Y55), H118 (= H113), W119 (= W114), N148 (= N143), Q169 (= Q165), W195 (≠ Y193), S196 (≠ C194), P197 (= P195), L198 (= L196), S200 (≠ Q198), L207 (= L207), A224 (= A224), I239 (= I240), P240 (= P241), K241 (= K242), S242 (≠ A243), R247 (≠ H248), E250 (≠ Q251), N251 (= N252)
1zuaX Crystal structure of akr1b10 complexed with NADP+ and tolrestat (see paper)
30% identity, 90% coverage: 14:268/284 of query aligns to 14:290/317 of 1zuaX
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G20), T21 (= T21), W22 (= W22), K23 (≠ E26), D45 (= D50), Y50 (= Y55), H112 (= H113), W113 (= W114), N162 (= N143), Q185 (= Q165), Y211 (= Y193), S212 (≠ C194), P213 (= P195), L214 (= L196), S216 (≠ Q198), P217 (≠ A199), D218 (≠ G200), A247 (= A224), I262 (= I240), P263 (= P241), K264 (= K242), S265 (≠ A243), V266 (≠ S244), T267 (≠ S245), R270 (≠ H248), E273 (≠ Q251), N274 (= N252)
- binding tolrestat: W22 (= W22), Y50 (= Y55), W81 (≠ Y82), H112 (= H113), W113 (= W114), F117 (vs. gap), F124 (vs. gap), W221 (vs. gap)
Sites not aligning to the query:
O60218 Aldo-keto reductase family 1 member B10; ARL-1; Aldose reductase-like; Aldose reductase-related protein; ARP; hARP; Small intestine reductase; SI reductase; EC 1.1.1.300; EC 1.1.1.54 from Homo sapiens (Human) (see 5 papers)
30% identity, 90% coverage: 14:268/284 of query aligns to 13:289/316 of O60218
- TW---K 20:22 (≠ TWYMGE 21:26) binding
- D44 (= D50) binding
- Y49 (= Y55) active site, Proton donor
- H111 (= H113) binding
- K125 (vs. gap) mutation to L: Increased affinity and reduced catalytic activity towards all-trans-retinaldehyde.
- SN 160:161 (= SN 142:143) binding
- Q184 (= Q165) binding
- 210:217 (vs. 193:200, 38% identical) binding
- 261:273 (vs. 240:252, 31% identical) binding
Sites not aligning to the query:
- 299 C→S: Decreased affinity and reduced catalytic activity towards 4-hydroxynonenal.
- 301 V→L: Reduced catalytic activity towards all-trans-retinaldehyde.
- 313 N → D: in dbSNP:rs4728329
4jiiX Crystal structure of akr1b10 complexed with NADP+ and zopolrestat (see paper)
30% identity, 90% coverage: 14:268/284 of query aligns to 15:291/318 of 4jiiX
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G21 (= G20), T22 (= T21), W23 (= W22), K24 (≠ E26), D46 (= D50), Y51 (= Y55), H113 (= H113), W114 (= W114), Q186 (= Q165), Y212 (= Y193), S213 (≠ C194), P214 (= P195), L215 (= L196), S217 (≠ Q198), P218 (≠ A199), D219 (≠ G200), A248 (= A224), I263 (= I240), P264 (= P241), K265 (= K242), S266 (≠ A243), V267 (≠ S244), T268 (≠ S245), R271 (≠ H248), E274 (≠ Q251), N275 (= N252)
- binding 3,4-dihydro-4-oxo-3-((5-trifluoromethyl-2-benzothiazolyl)methyl)-1-phthalazine acetic acid: W23 (= W22), Y51 (= Y55), W82 (≠ Y82), H113 (= H113), W114 (= W114), Q116 (vs. gap), F125 (vs. gap), W222 (vs. gap)
Sites not aligning to the query:
4jihA Crystal structure of akr1b10 complexed with NADP+ and epalrestat (see paper)
30% identity, 90% coverage: 14:268/284 of query aligns to 15:291/318 of 4jihA
- active site: D46 (= D50), Y51 (= Y55), K80 (= K80), H113 (= H113)
- binding {5-[(2E)-2-methyl-3-phenylprop-2-en-1-ylidene]-4-oxo-2-thioxo-1,3-thiazolidin-3-yl}acetic acid: W23 (= W22), Y51 (= Y55), H113 (= H113)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G21 (= G20), T22 (= T21), W23 (= W22), K24 (≠ E26), D46 (= D50), Y51 (= Y55), H113 (= H113), Q186 (= Q165), Y212 (= Y193), S213 (≠ C194), P214 (= P195), L215 (= L196), S217 (≠ Q198), P218 (≠ A199), D219 (≠ G200), A248 (= A224), I263 (= I240), K265 (= K242), S266 (≠ A243), T268 (≠ S245), R271 (≠ H248), E274 (≠ Q251), N275 (= N252)
4gq0A Crystal structure of akr1b10 complexed with NADP+ and caffeic acid phenethyl ester
30% identity, 90% coverage: 14:268/284 of query aligns to 15:291/318 of 4gq0A
- active site: D46 (= D50), Y51 (= Y55), K80 (= K80), H113 (= H113)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G21 (= G20), T22 (= T21), W23 (= W22), K24 (≠ E26), D46 (= D50), Y51 (= Y55), H113 (= H113), Q186 (= Q165), Y212 (= Y193), S213 (≠ C194), P214 (= P195), L215 (= L196), S217 (≠ Q198), P218 (≠ A199), D219 (≠ G200), A248 (= A224), I263 (= I240), P264 (= P241), K265 (= K242), S266 (≠ A243), T268 (≠ S245), R271 (≠ H248), E274 (≠ Q251), N275 (= N252)
- binding 2-phenylethyl (2E)-3-(3,4-dihydroxyphenyl)prop-2-enoate: W23 (= W22), Y51 (= Y55), H113 (= H113), F125 (vs. gap), P126 (vs. gap), K127 (vs. gap)
Sites not aligning to the query:
4gabA Human akr1b10 mutant v301l complexed with NADP+ and fidarestat (see paper)
30% identity, 90% coverage: 14:268/284 of query aligns to 13:289/316 of 4gabA
- active site: D44 (= D50), Y49 (= Y55), K78 (= K80), H111 (= H113)
- binding (2s,4s)-2-aminoformyl-6-fluoro-spiro[chroman-4,4'-imidazolidine]-2',5'-dione: W21 (= W22), V48 (≠ M54), Y49 (= Y55), W80 (≠ Y82), H111 (= H113), W112 (= W114), F123 (vs. gap), W220 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G20), T20 (= T21), W21 (= W22), K22 (≠ E26), D44 (= D50), Y49 (= Y55), H111 (= H113), N161 (= N143), Q184 (= Q165), Y210 (= Y193), S211 (≠ C194), P212 (= P195), L213 (= L196), S215 (≠ Q198), P216 (≠ A199), D217 (≠ G200), A246 (= A224), I261 (= I240), P262 (= P241), K263 (= K242), S264 (≠ A243), V265 (≠ S244), T266 (≠ S245), R269 (≠ H248), E272 (≠ Q251), N273 (= N252)
Sites not aligning to the query:
4ga8A Human akr1b10 mutant v301l complexed with NADP+ and sorbinil
30% identity, 90% coverage: 14:268/284 of query aligns to 13:289/316 of 4ga8A
- active site: D44 (= D50), Y49 (= Y55), K78 (= K80), H111 (= H113)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G20), T20 (= T21), W21 (= W22), K22 (≠ E26), D44 (= D50), Y49 (= Y55), H111 (= H113), N161 (= N143), Q184 (= Q165), Y210 (= Y193), S211 (≠ C194), P212 (= P195), L213 (= L196), S215 (≠ Q198), P216 (≠ A199), D217 (≠ G200), A246 (= A224), I261 (= I240), P262 (= P241), K263 (= K242), S264 (≠ A243), V265 (≠ S244), T266 (≠ S245), R269 (≠ H248), E272 (≠ Q251), N273 (= N252)
- binding sorbinil: W21 (= W22), Y49 (= Y55), W80 (≠ Y82), H111 (= H113), W112 (= W114), F123 (vs. gap)
4i5xA Crystal structure of akr1b10 complexed with NADP+ and flufenamic acid (see paper)
30% identity, 90% coverage: 14:268/284 of query aligns to 15:291/318 of 4i5xA
- active site: D46 (= D50), Y51 (= Y55), K80 (= K80), H113 (= H113)
- binding 2-[[3-(trifluoromethyl)phenyl]amino] benzoic acid: W23 (= W22), K24 (≠ E26), Y51 (= Y55), H113 (= H113), F125 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G21 (= G20), T22 (= T21), W23 (= W22), D46 (= D50), Y51 (= Y55), H113 (= H113), Q186 (= Q165), Y212 (= Y193), S213 (≠ C194), P214 (= P195), L215 (= L196), S217 (≠ Q198), P218 (≠ A199), L231 (= L207), A248 (= A224), I263 (= I240), P264 (= P241), K265 (= K242), S266 (≠ A243), V267 (≠ S244), T268 (≠ S245), R271 (≠ H248), E274 (≠ Q251), N275 (= N252)
5m2fX Crystal structure of human akr1b10 complexed with NADP+ and the synthetic retinoid uvi2008 (see paper)
30% identity, 90% coverage: 14:268/284 of query aligns to 13:289/316 of 5m2fX
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G20), T20 (= T21), W21 (= W22), D44 (= D50), Y49 (= Y55), H111 (= H113), N161 (= N143), Q184 (= Q165), Y210 (= Y193), S211 (≠ C194), P212 (= P195), L213 (= L196), S215 (≠ Q198), P216 (≠ A199), A246 (= A224), I261 (= I240), K263 (= K242), S264 (≠ A243), V265 (≠ S244), T266 (≠ S245), R269 (≠ H248), E272 (≠ Q251), N273 (= N252)
- binding 3-bromo-4-[(1E)-2-(5,5,8,8-tetramethyl-5,6,7,8-tetrahydronaphthalen-2-yl)prop-1-en-1-yl]benzoic acid: W21 (= W22), Y49 (= Y55), W80 (≠ Y82), H111 (= H113), F123 (vs. gap), R125 (vs. gap), A131 (vs. gap)
Sites not aligning to the query:
5liyX Crystal structure of human akr1b10 complexed with NADP+ and the inhibitor mk204 (see paper)
30% identity, 90% coverage: 14:268/284 of query aligns to 13:289/316 of 5liyX
- binding {5-chloro-2-[(pentabromobenzyl)carbamoyl]phenoxy}acetic acid: W21 (= W22), Y49 (= Y55), W80 (≠ Y82), H111 (= H113), W112 (= W114), F116 (vs. gap), W220 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G20), T20 (= T21), W21 (= W22), D44 (= D50), Y49 (= Y55), H111 (= H113), N161 (= N143), Q184 (= Q165), Y210 (= Y193), S211 (≠ C194), P212 (= P195), L213 (= L196), S215 (≠ Q198), P216 (≠ A199), D217 (≠ G200), A246 (= A224), I261 (= I240), P262 (= P241), K263 (= K242), S264 (≠ A243), T266 (≠ S245), R269 (≠ H248), E272 (≠ Q251), N273 (= N252)
Sites not aligning to the query:
Query Sequence
>BWI76_RS11495 FitnessBrowser__Koxy:BWI76_RS11495
MAERTIRFGEHPAVPVIGQGTWYMGENPALRAQEAAALRAGIDLGLTVIDTAEMYADGGA
EEVVGEAIRGQRDRVVLVSKVYPWNAGGRKIARACEASLRRLNTDYLDLYLLHWRGDYSL
QETVAGMEALVAQGKIRRWGVSNLDEDDMQQLWQVEGGERCATNQVLYHLASRGIEYDLL
PWCQQRRLPVMAYCPLAQAGRLRNGLLNHTVVKNIAQERGVTAAQILLAWVISHREVLAI
PKASSIEHVAQNAAALDIVLNDEELALLDKAYPAPARKTPLDMV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory