Comparing BWI76_RS11580 FitnessBrowser__Koxy:BWI76_RS11580 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A962 L-asparaginase 1; L-asparaginase I; L-ASNase I; L-asparagine amidohydrolase I; EC 3.5.1.1 from Escherichia coli (strain K12) (see paper)
91% identity, 100% coverage: 1:338/338 of query aligns to 1:338/338 of P0A962
6nxcB Ecai(t162a) mutant in complex with citrate at ph 4 (see paper)
89% identity, 100% coverage: 1:337/338 of query aligns to 8:336/336 of 6nxcB
2himA Crystal structure and allosteric regulation of the cytoplasmic escherichia coli l-asparaginase i (see paper)
88% identity, 99% coverage: 3:336/338 of query aligns to 1:324/324 of 2himA
7r6bB Crystal structure of mutant r43d/l124d/r125a/c273s of l-asparaginase i from yersinia pestis (see paper)
76% identity, 99% coverage: 3:335/338 of query aligns to 1:300/301 of 7r6bB
4r8lA Crystal structure of the asp-bound guinea pig l-asparaginase 1 catalytic domain (see paper)
43% identity, 99% coverage: 3:335/338 of query aligns to 1:352/354 of 4r8lA
5dndD Crystal structure of the asn-bound guinea pig l-asparaginase 1 catalytic domain active site mutant t116a (see paper)
43% identity, 99% coverage: 3:335/338 of query aligns to 1:352/357 of 5dndD
5ot0A The thermostable l-asparaginase from thermococcus kodakarensis (see paper)
35% identity, 98% coverage: 5:335/338 of query aligns to 2:326/328 of 5ot0A
4q0mA Crystal structure of pyrococcus furiosus l-asparaginase (see paper)
33% identity, 96% coverage: 12:334/338 of query aligns to 10:325/327 of 4q0mA
Q8TZE8 L-asparaginase; EC 3.5.1.1 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see 2 papers)
33% identity, 96% coverage: 12:334/338 of query aligns to 9:324/326 of Q8TZE8
1zq1A Structure of gatde tRNA-dependent amidotransferase from pyrococcus abyssi (see paper)
32% identity, 82% coverage: 60:336/338 of query aligns to 145:428/437 of 1zq1A
Sites not aligning to the query:
5b5uA Crystal structure of truncated pyrococcus furiosus l-asparaginase with peptide (see paper)
35% identity, 49% coverage: 12:176/338 of query aligns to 9:167/175 of 5b5uA
Sites not aligning to the query:
4njeA Crystal structure of pyrococcus furiosus l-asparaginase with ligand (see paper)
35% identity, 49% coverage: 12:176/338 of query aligns to 9:167/182 of 4njeA
8h4aB Blasnase-t13a/m57p
26% identity, 92% coverage: 3:314/338 of query aligns to 1:309/328 of 8h4aB
7c8qA Blasnase-t13a with d-asn (see paper)
26% identity, 92% coverage: 3:314/338 of query aligns to 1:309/321 of 7c8qA
P00805 L-asparaginase 2; L-asparaginase II; L-ASNase II; L-asparagine amidohydrolase II; Colaspase; EC 3.5.1.1 from Escherichia coli (strain K12) (see 5 papers)
30% identity, 64% coverage: 60:276/338 of query aligns to 80:298/348 of P00805
Sites not aligning to the query:
1ho3A Crystal structure analysis of e. Coli l-asparaginase ii (y25f mutant) (see paper)
30% identity, 64% coverage: 60:276/338 of query aligns to 58:276/326 of 1ho3A
Sites not aligning to the query:
7r5qA Escherichia coli type ii asparaginase n24s mutant in complex with glu (see paper)
30% identity, 64% coverage: 60:276/338 of query aligns to 38:256/306 of 7r5qA
Sites not aligning to the query:
7cbuA Blasnase-t13a with l-asp (see paper)
25% identity, 92% coverage: 3:314/338 of query aligns to 1:306/318 of 7cbuA
2wltA The crystal structure of helicobacter pylori l-asparaginase at 1.4 a resolution (see paper)
26% identity, 96% coverage: 5:328/338 of query aligns to 3:325/326 of 2wltA
1jazA Crystal structure of monoclinic form of d90e mutant of escherichia coli asparaginase ii (see paper)
30% identity, 64% coverage: 60:276/338 of query aligns to 39:257/307 of 1jazA
Sites not aligning to the query:
>BWI76_RS11580 FitnessBrowser__Koxy:BWI76_RS11580
MQKKSIYVAYTGGTIGMQRSEHGYIPVSGHLQRQLALMPEFHRPEMPDFTIHEYAPLMDS
SDMTPEDWQHIADDIRDHYDQYDGFVILHGTDTMAFTASALSFMLENLGKPVIVTGSQIP
LAELRSDGQINLLNALYVAANYPINEVSLFFNNRLYRGNRTTKAHADGFNAFASPNLAPL
LEAGIHIRRLGTPPAPHGSGELVVHPITPQPIGVVTIYPGISADVVRNFLRQPVKALILR
SYGVGNAPQNGEFIQVLTEASQRGIVVVNLTQCMSGKVNMGGYATGNALAQAGVISGFDM
TVEATLTKLHYLLSQDLDVAAIRHAMQENLRGELTPDE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory