Comparing BWI76_RS14190 FitnessBrowser__Koxy:BWI76_RS14190 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
5cgzA Crystal structure of galb, the 4-carboxy-2-hydroxymuconate hydratase, from pseuodomonas putida kt2440 (see paper)
84% identity, 97% coverage: 8:246/246 of query aligns to 2:240/240 of 5cgzA
Q81ST8 N-acetyl-alpha-D-glucosaminyl L-malate deacetylase 1; GlcNAc-Mal deacetylase 1; EC 3.5.1.- from Bacillus anthracis (see paper)
26% identity, 93% coverage: 11:239/246 of query aligns to 7:222/234 of Q81ST8
2ixdA Crystal structure of the putative deacetylase bc1534 from bacillus cereus (see paper)
25% identity, 93% coverage: 11:239/246 of query aligns to 6:221/232 of 2ixdA
Q81FP2 N-acetyl-alpha-D-glucosaminyl L-malate deacetylase 1; GlcNAc-Mal deacetylase 1; B.cereus zinc-binding protein; BcZBP; EC 3.5.1.- from Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) (see 2 papers)
25% identity, 93% coverage: 11:239/246 of query aligns to 7:222/234 of Q81FP2
8bgoG N,n-diacetylchitobiose deacetylase from pyrococcus chitonophagus with substrate n,n-diacetylchitobiose (see paper)
24% identity, 96% coverage: 1:235/246 of query aligns to 28:255/271 of 8bgoG
5b2eA N,n'-diacetylchitobiose deacetylase from pyrococcus horikoshii complexed with its inhibitor mpg (acetate-containing condition) (see paper)
25% identity, 83% coverage: 1:203/246 of query aligns to 23:225/267 of 5b2eA
3wl3A N,n'-diacetylchitobiose deacetylase from pyrococcus horikoshii (see paper)
25% identity, 83% coverage: 1:203/246 of query aligns to 23:225/267 of 3wl3A
6p2tA Bshb from bacillus subtilis complexed with citrate (see paper)
28% identity, 76% coverage: 11:198/246 of query aligns to 5:178/232 of 6p2tA
6ullA Bshb from bacillus subtilis complexed with a substrate analogue (see paper)
28% identity, 76% coverage: 11:198/246 of query aligns to 5:178/231 of 6ullA
Sites not aligning to the query:
4xm0A N,n'-diacetylchitobiose deacetylase (semet derivative) from pyrococcus furiosus in the absence of cadmium (see paper)
23% identity, 80% coverage: 8:203/246 of query aligns to 29:222/264 of 4xm0A
4xm1A N,n'-diacetylchitobiose deacetylase from pyrococcus furiosus in the presence of cadmium (see paper)
23% identity, 80% coverage: 8:203/246 of query aligns to 28:221/263 of 4xm1A
3wl4A N,n'-diacetylchitobiose deacetylase (se-derivative) from pyrococcus furiosus (see paper)
23% identity, 80% coverage: 8:203/246 of query aligns to 32:225/267 of 3wl4A
1q7tA Rv1170 (mshb) from mycobacterium tuberculosis (see paper)
28% identity, 58% coverage: 11:153/246 of query aligns to 21:181/310 of 1q7tA
Sites not aligning to the query:
>BWI76_RS14190 FitnessBrowser__Koxy:BWI76_RS14190
MSQPIREKSALVVSAHSADFVWRAGGAIALHVEQGYQVHIVCLSFGERGESAKLWRKGNM
TEETVKHHRREEAQAAADILGASVEFFDIGDYPLRADKETLFRLADVYRRVQPHFVLTHS
MQDPYNYDHPMASNLAQEARIIAQAEGYRPGEPVVQAPPVYCFEPHQPEQCSWKPDVLLD
ITRVWEKKYQAIQCMQGQEHLWEYYTRVALQRGVQAKRNIGITAARDIVHAEGFQSIFPR
VTENLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory