Comparing BWI76_RS14445 FitnessBrowser__Koxy:BWI76_RS14445 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
53% identity, 90% coverage: 25:250/250 of query aligns to 1:226/226 of 8eyzA
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
48% identity, 87% coverage: 29:245/250 of query aligns to 6:225/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
48% identity, 88% coverage: 29:247/250 of query aligns to 6:225/225 of 4zv2A
4g4pA Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a (see paper)
41% identity, 88% coverage: 21:240/250 of query aligns to 8:229/235 of 4g4pA
2pvuA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
38% identity, 89% coverage: 28:250/250 of query aligns to 6:229/235 of 2pvuA
2q2cA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
38% identity, 89% coverage: 28:250/250 of query aligns to 2:225/231 of 2q2cA
2q2aA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
38% identity, 89% coverage: 28:250/250 of query aligns to 12:235/241 of 2q2aA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
35% identity, 88% coverage: 29:247/250 of query aligns to 3:224/224 of 4ymxA
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
39% identity, 89% coverage: 23:245/250 of query aligns to 6:228/229 of 5t0wA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
38% identity, 88% coverage: 29:247/250 of query aligns to 12:229/229 of 6svfA
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
33% identity, 96% coverage: 8:246/250 of query aligns to 8:254/260 of P02911
4kqpA Crystal structure of lactococcus lactis glnp substrate binding domain 2 (sbd2) in complex with glutamine at 0.95 a resolution (see paper)
34% identity, 90% coverage: 22:245/250 of query aligns to 1:226/230 of 4kqpA
5owfA Structure of a lao-binding protein mutant with glutamine (see paper)
34% identity, 87% coverage: 29:246/250 of query aligns to 3:229/235 of 5owfA
4zefA Crystal structure of substrate binding domain 2 (sbd2) of abc transporter glnpq from enterococcus faecalis
35% identity, 86% coverage: 26:240/250 of query aligns to 15:231/239 of 4zefA
1lstA Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand (see paper)
33% identity, 87% coverage: 29:246/250 of query aligns to 6:232/238 of 1lstA
1lahE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
33% identity, 87% coverage: 29:246/250 of query aligns to 6:232/238 of 1lahE
1lagE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
33% identity, 87% coverage: 29:246/250 of query aligns to 6:232/238 of 1lagE
1lafE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
33% identity, 87% coverage: 29:246/250 of query aligns to 6:232/238 of 1lafE
8b5dA Exploring the ligand binding and conformational dynamics of receptor domain 1 of the abc transporter glnpq
33% identity, 86% coverage: 29:244/250 of query aligns to 2:219/223 of 8b5dA
6fxgB Crystal structure of substrate binding domain 1 (sbd1) of abc transporter glnpq in complex with asparagine
32% identity, 86% coverage: 29:244/250 of query aligns to 5:222/226 of 6fxgB
>BWI76_RS14445 FitnessBrowser__Koxy:BWI76_RS14445
MSALLKKLKITLALVACSASFAVMAQDKILVGVDTAFVPFEFKQGNKYVGFDIDLWQAIA
KKMNVSYELRPMDFSGLIPGLQSRNLDVAMAGITITDARKQVVDFSDGYYDADLLMAVKS
GDDSITKFSELAGKKVGLKQGTAAAIFMKSKYKANYVEFPNIDNAYLDLQAGNLDAVVHD
SPNVLYYVKTAGGGKVKSTGETDSILPQKYGFALQKNSSLTPKVDAALNALRADGTYDKI
YFKWFNKQPK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory