Comparing BWI76_RS15025 FitnessBrowser__Koxy:BWI76_RS15025 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
4qhqA The structure of a nutrient binding protein from burkholderia cenocepacia bound to methionine
45% identity, 88% coverage: 27:262/268 of query aligns to 2:238/241 of 4qhqA
4ib2A Crystal structure of a putative lipoprotein (rumgna_00858) from ruminococcus gnavus atcc 29149 at 1.76 a resolution
41% identity, 91% coverage: 20:263/268 of query aligns to 1:245/247 of 4ib2A
4yahX Crystal structure of the methionine binding protein, metq (see paper)
42% identity, 84% coverage: 37:262/268 of query aligns to 18:240/245 of 4yahX
3tqwA Structure of a abc transporter, periplasmic substrate-binding protein from coxiella burnetii (see paper)
40% identity, 88% coverage: 27:263/268 of query aligns to 2:234/235 of 3tqwA
1xs5A The crystal structure of lipoprotein tp32 from treponema pallidum (see paper)
36% identity, 87% coverage: 35:266/268 of query aligns to 13:239/240 of 1xs5A
P04846 Lipoprotein 28 from Escherichia coli (strain K12) (see paper)
37% identity, 85% coverage: 37:263/268 of query aligns to 47:270/272 of P04846
Sites not aligning to the query:
3k2dA Crystal structure of immunogenic lipoprotein a from vibrio vulnificus (see paper)
38% identity, 75% coverage: 49:249/268 of query aligns to 33:228/237 of 3k2dA
4oteB Crystal structure of a putative lipoprotein (cd630_1653) from clostridium difficile 630 at 2.20 a resolution
35% identity, 88% coverage: 29:263/268 of query aligns to 8:238/240 of 4oteB
6jf1A Crystal structure of the substrate binding protein of a methionine transporter from streptococcus pneumoniae (see paper)
35% identity, 80% coverage: 28:242/268 of query aligns to 20:234/260 of 6jf1A
Sites not aligning to the query:
3gxaC Crystal structure of gna1946 (see paper)
35% identity, 83% coverage: 44:265/268 of query aligns to 18:238/244 of 3gxaC
6dzxA Crystal structure of the n. Meningitides methionine-binding protein in its d-methionine bound conformation. (see paper)
36% identity, 80% coverage: 52:265/268 of query aligns to 30:237/240 of 6dzxA
1p99A 1.7a crystal structure of protein pg110 from staphylococcus aureus (see paper)
43% identity, 60% coverage: 64:225/268 of query aligns to 40:201/255 of 1p99A
Sites not aligning to the query:
4ntlA Crystal structure of a lipoprotein, yaec family (ef3198) from enterococcus faecalis v583 at 1.80 a resolution
32% identity, 79% coverage: 52:263/268 of query aligns to 31:240/242 of 4ntlA
Sites not aligning to the query:
>BWI76_RS15025 FitnessBrowser__Koxy:BWI76_RS15025
MKYAAFKLAGVALSLSLAWTSAQAAALRVAADPVPHAEILNYIKKIDPSLDLKIVELTSG
VNANELLANGDVDANYFQHVPYLKDQEKALGKTFAVAATVHIEPLGIYSRKHKDFKSLPE
NATVAVPNNTTNLSRALFLLQNQGLIKLAAKFTDPATTLATPKDIVENPKHLKILEIESP
QIPRSLDDVDLAVINGNYALEAGLVPAKDALGLESATNNPYANILVTTPALANDPRIKAL
AKDLTSPQVAEFIRKQYNGSVIPVAPQS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory