SitesBLAST
Comparing BWI76_RS16110 FitnessBrowser__Koxy:BWI76_RS16110 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
Q9FMF7 Dicarboxylate transporter 2.1, chloroplastic; AtpDCT1; Glutamate/malate translocator from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 93% coverage: 21:484/501 of query aligns to 95:544/563 of Q9FMF7
- G206 (= G149) mutation to E: In dct; photorespiratory phenotype leading to non-viable seedlings under normal atmospheric conditions.
7jsjA Structure of the nact-pf2 complex (see paper)
23% identity, 78% coverage: 113:501/501 of query aligns to 70:458/468 of 7jsjA
- binding sodium ion: S124 (≠ A167), I127 (≠ T170), S128 (= S172), N129 (= N173), G172 (≠ A226), T366 (≠ H406), T369 (≠ A410), S370 (= S411), N371 (≠ T412), A413 (≠ G456), T414 (= T457)
- binding (2R)-2-[2-(4-tert-butylphenyl)ethyl]-2-hydroxybutanedioic acid: N129 (= N173), T130 (= T174), T173 (≠ L227), G315 (≠ N354), I316 (≠ T355), N371 (≠ T412)
Q86YT5 Na(+)/citrate cotransporter; NaCT; Sodium-coupled citrate transporter; Sodium-dependent citrate transporter; Solute carrier family 13 member 5 from Homo sapiens (Human) (see 5 papers)
26% identity, 32% coverage: 340:501/501 of query aligns to 396:552/568 of Q86YT5
- G409 (≠ N354) mutation to Q: No effect on its function in citrate transport.
- I410 (≠ T355) mutation I->A,F: Significant loss of function in citrate transport.; mutation to V: No effect on its function in citrate transport.
- L420 (= L365) to P: loss of localization to plasma membrane; loss of function in citrate transport; dbSNP:rs150738356
- S427 (≠ T372) to L: in DEE25; loss of localization to plasma membrane; loss of function in citrate transport; dbSNP:rs548065551
- L485 (≠ M433) to R: no effect on localization to plasma membrane; reduced function in citrate transport; increased Km and Vmax values compared with that of wild type with citrate as substrate; dbSNP:rs148049520
- L488 (≠ V437) to P: in DEE25; loss of function in citrate transport; loss of localization to plasma membrane; dbSNP:rs587777578
- D524 (= D473) to H: in DEE25; loss of function in citrate transport; no effect on localization to plasma membrane; dbSNP:rs863225448
Sites not aligning to the query:
- 142 T → M: in DEE25; no loss of localization to plasma membrane; loss of function in citrate transport; dbSNP:rs761917087
- 219 G → E: loss of localization to plasma membrane; loss of function in citrate transport; dbSNP:rs150024888; G → R: in DEE25; loss of function in citrate transport; loss of localization to plasma membrane; dbSNP:rs144332569
- 227 T → M: in DEE25; loss of function in citrate transport; no effect on localization to plasma membrane; dbSNP:rs587777577
- 243 D → N: no effect on localization to plasma membrane; no effect on its function in citrate transport; dbSNP:rs142262032
- 341:568 natural variant: Missing (in DEE25; loss of localization to plasma membrane; loss of function in citrate transport)
- 562 modified: carbohydrate, N-linked (GlcNAc...) asparagine
6okzB Structure of vcindy bound to fumarate
24% identity, 74% coverage: 107:478/501 of query aligns to 68:424/444 of 6okzB
7t9gA Structure of vcindy-na+ (see paper)
24% identity, 74% coverage: 107:478/501 of query aligns to 69:425/445 of 7t9gA
6wtxA Structure of vcindy in complex with terephthalate (see paper)
24% identity, 74% coverage: 107:478/501 of query aligns to 69:425/445 of 6wtxA
- binding sodium ion: S129 (≠ P168), S133 (= S172), N134 (= N173), G176 (≠ S220), G182 (≠ A226), T356 (≠ Y407), A359 (= A410), S360 (= S411), N361 (≠ T412), A403 (≠ G456)
- binding terephthalic acid: N134 (= N173), S183 (≠ L227), S360 (= S411), N361 (≠ T412), T362 (= T413), T404 (= T457)
Query Sequence
>BWI76_RS16110 FitnessBrowser__Koxy:BWI76_RS16110
MKEKQTTIPPAGAAKNAAYKRLLMMAMPIIVAVLLLFVPVPEGLPPYAWHYFAIFVGVIV
GLIFEPLPGAVIGITGVVVIALCSQWLLFSPEQLAAPNFKLAGASFKWAVSGFGNSTVWL
IFGAFMFAAGYDKTQFGRRLALILVKYLGRRSLTLGYAITFADLLLAPFTPSNTARSGGT
IYPIIANLPPLYGSKPNDPSARRIGSYLMWVAITAACITSSMFLSALAPNLLALALVKSI
VGINISWGTWFIAFLPLGILLILTMPLLAYWFYPPEVKVNDEVPLWAARELEKLGRLSRN
EILLLVFVCFALMMWIFAAEWIEPALAALLVIVLMLWTGVLSWNDITSNKAAWNTFAWFA
TLVALADGLSSTGFIAWLGKEGGALMSGISPGVATVVLLLAFYLLHYLFASTTAHTTALL
PAMLTIASTIPGMNMQVFVLLMVTSLGVMGIITPYGTGPSPIYYGSGYLPTKDYWRLGTI
FGAIFLAALLLIGYPWMSMMF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory