Comparing BWI76_RS16125 FitnessBrowser__Koxy:BWI76_RS16125 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2xuaH Crystal structure of the enol-lactonase from burkholderia xenovorans lb400 (see paper)
47% identity, 96% coverage: 5:248/255 of query aligns to 13:259/261 of 2xuaH
4uheA Structural studies of a thermophilic esterase from thermogutta terrifontis (malate bound) (see paper)
27% identity, 90% coverage: 16:244/255 of query aligns to 28:263/272 of 4uheA
4uhfA Structural studies of a thermophilic esterase from thermogutta terrifontis (l37a mutant with butyrate bound) (see paper)
27% identity, 90% coverage: 16:244/255 of query aligns to 28:263/278 of 4uhfA
4uhdA Structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) (see paper)
27% identity, 90% coverage: 16:244/255 of query aligns to 28:263/274 of 4uhdA
5cbkA Crystal structure of the strigolactone receptor shhtl5 from striga hermonthica (see paper)
24% identity, 87% coverage: 16:237/255 of query aligns to 20:253/271 of 5cbkA
Sites not aligning to the query:
8dvcA Receptor shhtl5 from striga hermonthica in complex with strigolactone agonist gr24 (see paper)
24% identity, 87% coverage: 16:237/255 of query aligns to 18:251/268 of 8dvcA
5z7xA Crystal structure of striga hermonthica htl4 (shhtl4) (see paper)
24% identity, 87% coverage: 16:238/255 of query aligns to 21:255/270 of 5z7xA
6eb3C Structural and enzymatic characterization of an esterase from a metagenomic library
26% identity, 97% coverage: 1:248/255 of query aligns to 9:257/262 of 6eb3C
6eb3A Structural and enzymatic characterization of an esterase from a metagenomic library
27% identity, 97% coverage: 1:248/255 of query aligns to 9:260/265 of 6eb3A
6eb3B Structural and enzymatic characterization of an esterase from a metagenomic library
26% identity, 97% coverage: 1:248/255 of query aligns to 9:263/268 of 6eb3B
5dnuA Crystal structure of striga kai2-like protein in complex with karrikin (see paper)
22% identity, 93% coverage: 16:251/255 of query aligns to 18:265/267 of 5dnuA
5z7yA Crystal structure of striga hermonthica htl7 (shhtl7) (see paper)
22% identity, 88% coverage: 16:239/255 of query aligns to 19:254/267 of 5z7yA
7snuA Crystal structure of shhtl7 from striga hermonthica in complex with strigolactone antagonist rg6 (see paper)
22% identity, 88% coverage: 16:239/255 of query aligns to 21:256/270 of 7snuA
7c8lA Hybrid designing of potent inhibitors of striga strigolactone receptor shhtl7 (see paper)
22% identity, 88% coverage: 16:239/255 of query aligns to 18:253/268 of 7c8lA
7k38A Crystal structure of pisum sativum kai2 in complex with gr24-ent5ds product (see paper)
21% identity, 92% coverage: 16:249/255 of query aligns to 20:265/270 of 7k38A
5frdA Structure of a thermophilic esterase (see paper)
29% identity, 68% coverage: 76:249/255 of query aligns to 79:247/256 of 5frdA
5z89A Structural basis for specific inhibition of highly sensitive shhtl7 receptor (see paper)
21% identity, 88% coverage: 16:239/255 of query aligns to 18:253/268 of 5z89A
2ociA Crystal structure of valacyclovir hydrolase complexed with a product analogue (see paper)
24% identity, 98% coverage: 1:249/255 of query aligns to 12:254/254 of 2ociA
2ocgA Crystal structure of human valacyclovir hydrolase (see paper)
24% identity, 98% coverage: 1:249/255 of query aligns to 12:254/254 of 2ocgA
Q86WA6 Valacyclovir hydrolase; VACVase; Valacyclovirase; Biphenyl hydrolase-like protein; Biphenyl hydrolase-related protein; Bph-rp; Breast epithelial mucin-associated antigen; MCNAA; EC 3.1.-.- from Homo sapiens (Human) (see 2 papers)
24% identity, 98% coverage: 1:249/255 of query aligns to 49:291/291 of Q86WA6
Sites not aligning to the query:
>BWI76_RS16125 FitnessBrowser__Koxy:BWI76_RS16125
MNVDYQIDGPQDAPVIVLSNSLGTTRAMWQPQLEALTQHFRVLRYDTHGHGATRKNGKVT
LAQLGEDVVALLDHLNIAKAWFCGISMGGLTGLWLGRFAPERFYGLVVANTAARIGDQAS
WLSRARAVRQEGMDVVAAGAADRWFTHAFRQKTPEVVAALCHQLTHIDAEGYAACCEALA
AADLRAEVAQIPIPVLIVAGESDPVTTVADADFLHQQIPVSEVVVLAASHLSNIEAPKAF
SSALLGFVQGEKHGR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory