SitesBLAST
Comparing BWI76_RS16230 FitnessBrowser__Koxy:BWI76_RS16230 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5bt9C Crystal structure of folm alternative dihydrofolate reductase 1 from brucella canis complexed with NADP (see paper)
29% identity, 97% coverage: 8:240/241 of query aligns to 9:242/250 of 5bt9C
- active site: R18 (= R17), I140 (= I138), Y155 (= Y153), K159 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R18 (= R17), I19 (= I18), C38 (≠ Y37), N39 (≠ R38), R40 (≠ T39), S41 (≠ W40), L66 (≠ F59), E67 (≠ S60), N90 (= N86), S92 (= S88), I140 (= I138), K159 (= K157), P184 (= P182), G185 (≠ S183), T187 (≠ I185), L188 (= L186)
4bo6A Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 2,3-dihydroindol-1-yl-(2- thiophen-3-yl-1,3-thiazol-4-yl)methanone at 2.8a resolution (see paper)
30% identity, 99% coverage: 3:240/241 of query aligns to 4:232/233 of 4bo6A
- active site: G18 (≠ R17), S130 (≠ D140), Y140 (= Y153), K144 (= K157)
- binding 2,3-dihydroindol-1-yl-(2-thiophen-3-yl-1,3-thiazol-4-yl)methanone: F96 (≠ M91), V99 (≠ M107), N100 (≠ Q108), L103 (≠ V111), G149 (≠ N162), F150 (≠ M163)
4ag3A Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with NADPH at 1.8a resolution (see paper)
30% identity, 98% coverage: 4:240/241 of query aligns to 10:253/254 of 4ag3A
- active site: G23 (≠ R17), S148 (≠ D140), Y161 (= Y153), K165 (= K157)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G19 (= G13), S21 (≠ G15), R22 (= R16), G23 (≠ R17), I24 (= I18), T44 (= T39), L68 (≠ A57), D69 (= D58), V70 (≠ F59), N96 (= N86), A97 (= A87), I146 (= I138), S148 (≠ D140), Y161 (= Y153), K165 (= K157), P191 (= P182), G192 (≠ S183), F193 (≠ L184), I194 (= I185), T196 (≠ F187), M198 (≠ E189), T199 (≠ G190)
Q9NUI1 Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing]; pDCR; 2,4-dienoyl-CoA reductase 2; Short chain dehydrogenase/reductase family 17C member 1; EC 1.3.1.124 from Homo sapiens (Human) (see paper)
28% identity, 96% coverage: 10:240/241 of query aligns to 32:273/292 of Q9NUI1
- GGGSGI 35:40 (≠ GGGRRI 13:18) binding
- RSLPR 60:64 (≠ RTWYP 38:42) binding
- D86 (= D58) binding ; mutation to A: Reduces enzyme activity by 98%.
- D137 (≠ H110) mutation to A: Reduces enzyme activity by 97%.
- K182 (= K157) binding
- D186 (= D161) mutation to A: Reduces enzyme activity by about 95%.
- 208:214 (vs. 182:188, 29% identical) binding
- D268 (= D235) mutation to A: Reduces enzyme activity by 97%.
4fc6B Studies on dcr shed new light on peroxisomal beta-oxidation: crystal structure of the ternary complex of pdcr (see paper)
30% identity, 96% coverage: 10:240/241 of query aligns to 30:271/276 of 4fc6B
- active site: G37 (≠ R17), A163 (≠ D140), Q173 (≠ H150), H175 (≠ A152), A176 (≠ Y153), K180 (= K157)
- binding hexanoyl-coenzyme a: G114 (= G89), N115 (≠ W90), F116 (≠ M91), S124 (≠ L99), N126 (≠ T101), A127 (≠ V102), T130 (≠ S105), L165 (≠ V142), R217 (≠ A193)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G33 (= G13), S36 (≠ R16), G37 (≠ R17), I38 (= I18), S57 (≠ Y37), R58 (= R38), S59 (≠ T39), R62 (≠ P42), M83 (≠ A57), D84 (= D58), V85 (≠ F59), C111 (≠ N86), A112 (= A87), A113 (≠ S88), I134 (= I109), I161 (= I138), K180 (= K157), P206 (= P182), G207 (≠ S183), T212 (≠ N188), E213 (= E189), G214 (= G190)
4fc7A Studies on dcr shed new light on peroxisomal beta-oxidation: crystal structure of the ternary complex of pdcr (see paper)
28% identity, 96% coverage: 10:240/241 of query aligns to 29:270/274 of 4fc7A
- active site: G36 (≠ R17), A162 (≠ D140), Q172 (≠ H150), H174 (≠ A152), A175 (≠ Y153), K179 (= K157)
- binding coenzyme a: R57 (= R38), R85 (≠ S60), G113 (= G89), N114 (≠ W90), F115 (≠ M91), S123 (≠ L99), N125 (≠ T101), A126 (≠ V102), T129 (≠ S105), R216 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G32 (= G13), S35 (≠ R16), G36 (≠ R17), I37 (= I18), S56 (≠ Y37), R57 (= R38), S58 (≠ T39), R61 (≠ P42), D83 (= D58), V84 (≠ F59), R85 (≠ S60), C110 (≠ N86), A111 (= A87), A112 (≠ S88), I160 (= I138), K179 (= K157), P205 (= P182), G206 (≠ S183), T211 (≠ N188), E212 (= E189), G213 (vs. gap)
4bo7A Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with n-(2,3-dihydro-1h-inden- 5-yl)tetrazolo(1,5-b)pyridazin-6-amine at 2.6a resolution (see paper)
29% identity, 98% coverage: 4:240/241 of query aligns to 5:237/238 of 4bo7A
6rxcD Leishmania major pteridine reductase 1 (lmptr1) in complex with inhibitor 4 (nmt-c0026) (see paper)
26% identity, 96% coverage: 10:240/241 of query aligns to 6:253/256 of 6rxcD
- active site: R13 (= R17), D155 (= D140), Y168 (= Y153)
- binding methyl 1-[4-[[2,4-bis(azanyl)pteridin-6-yl]methyl-(3-oxidanylpropyl)amino]phenyl]carbonylpiperidine-4-carboxylate: S99 (= S88), F101 (≠ W90), Y165 (≠ H150), Y168 (= Y153), L200 (vs. gap)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R13 (= R17), L14 (≠ I18), H32 (≠ S36), Y33 (= Y37), H34 (vs. gap), R35 (vs. gap), S36 (vs. gap), D61 (= D58), L62 (≠ F59), N97 (= N86), A98 (= A87), S99 (= S88), S100 (≠ G89), M153 (≠ I138), D155 (= D140), K172 (= K157), P198 (= P182), S201 (= S183)
4bnyA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 4-(2-phenylthieno(3,2-d) pyrimidin-4-yl)morpholine at 1.8a resolution (see paper)
29% identity, 98% coverage: 4:240/241 of query aligns to 4:238/239 of 4bnyA
4bnxA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 6-(4-(2-chloroanilino)- 1h-quinazolin-2-ylidene)cyclohexa-2, 4-dien-1-one at 2.3a resolution (see paper)
29% identity, 98% coverage: 4:240/241 of query aligns to 5:239/239 of 4bnxA
- active site: G18 (≠ R17), S134 (≠ D140), Y147 (= Y153), K151 (= K157)
- binding 6-[4-(2-chloroanilino)-1H-quinazolin-2-ylidene]cyclohexa-2,4-dien-1-one: V103 (≠ M107), N104 (≠ Q108), L107 (≠ V111), A149 (= A155), G153 (≠ A159), G156 (≠ N162), F157 (≠ M163)
5ha5D Crystal structure of an NAD-bound oxidoreductase from brucella ovis
27% identity, 97% coverage: 4:237/241 of query aligns to 4:240/244 of 5ha5D
- active site: G17 (≠ R17), S142 (≠ D140), Y155 (= Y153), K159 (= K157)
- binding nicotinamide-adenine-dinucleotide: G13 (= G13), R16 (= R16), G17 (≠ R17), L18 (≠ I18), D37 (vs. gap), I38 (= I35), L62 (≠ D58), D63 (≠ F59), V64 (≠ S60), N90 (= N86), A91 (= A87), S142 (≠ D140), Y155 (= Y153), K159 (= K157), G186 (≠ S183), M188 (≠ I185), S190 (≠ F187)
5iz4A Crystal structure of a putative short-chain dehydrogenase/reductase from burkholderia xenovorans
27% identity, 95% coverage: 9:237/241 of query aligns to 7:243/247 of 5iz4A
- active site: G15 (≠ R17), S150 (≠ D140), S159 (≠ K149), Y163 (= Y153), K167 (= K157)
- binding adenosine-5'-diphosphate: G11 (= G13), S14 (≠ R16), G15 (≠ R17), I16 (= I18), F36 (vs. gap), A63 (= A57), D64 (= D58), V65 (≠ F59), A92 (≠ S77), G93 (= G78), V117 (≠ I109)
6rx5A Trypanosoma brucei ptr1 (tbptr1) in complex with inhibitor 1 (nmt- c0003) (see paper)
27% identity, 96% coverage: 10:240/241 of query aligns to 6:255/258 of 6rx5A
- active site: R13 (= R17), D151 (= D140), Y164 (= Y153), K168 (= K157)
- binding methyl 1-(4-{[(2,4-diaminopteridin-6-yl)methyl](methyl)amino}benzoyl)piperidine-4-carboxylate: R13 (= R17), S94 (= S88), F96 (≠ W90), P98 (≠ E93), F161 (≠ H150), Y164 (= Y153), P200 (vs. gap), W211 (≠ Y195)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R17), I14 (= I18), H32 (≠ S36), Y33 (= Y37), H34 (≠ R38), N35 (≠ T39), S36 (≠ W40), L62 (≠ F59), N92 (= N86), A93 (= A87), S94 (= S88), T116 (≠ I109), L149 (≠ I138), K168 (= K157), P194 (= P182), G195 (≠ S183), S197 (≠ I185)
6gd0A Trypanosoma brucei ptr1 in complex with inhibitor 4g (f133) (see paper)
27% identity, 96% coverage: 10:240/241 of query aligns to 6:251/254 of 6gd0A
- active site: R13 (= R17), D147 (= D140), Y160 (= Y153), K164 (= K157)
- binding methyl 1-[4-[[(2-azanyl-1,3-benzothiazol-6-yl)carbonylamino]methyl]phenyl]carbonylpiperidine-4-carboxylate: S94 (= S88), F96 (≠ W90), C154 (≠ S147), Y160 (= Y153), A198 (vs. gap), M199 (vs. gap), W207 (≠ Y195)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R17), I14 (= I18), Y33 (= Y37), H34 (≠ R38), N35 (≠ T39), S36 (≠ W40), L62 (≠ F59), N92 (= N86), S94 (= S88), T117 (≠ I109), L145 (≠ I138), K164 (= K157), P190 (= P182), G191 (≠ S183), V192 (≠ L184), S193 (≠ I185), L194 (= L186)
7pxxA The crystal structure of leishmania major pteridine reductase 1 in complex with substrate folic acid (see paper)
26% identity, 96% coverage: 10:240/241 of query aligns to 6:261/264 of 7pxxA
- binding folic acid: S100 (= S88), F102 (≠ W90), L164 (≠ S147), Y167 (≠ H150), Y170 (= Y153), L202 (= L184), H217 (≠ Q198)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R13 (= R17), L14 (≠ I18), H32 (≠ S36), Y33 (= Y37), H34 (vs. gap), R35 (vs. gap), S36 (vs. gap), L62 (≠ F59), N98 (= N86), A99 (= A87), S100 (= S88), S101 (≠ G89), M155 (≠ I138), V156 (≠ T139), D157 (= D140), Y170 (= Y153), K174 (= K157), P200 (= P182), G201 (≠ S183), S203 (vs. gap)
2qhxA Structure of pteridine reductase from leishmania major complexed with a ligand (see paper)
26% identity, 96% coverage: 10:240/241 of query aligns to 6:261/264 of 2qhxA
- active site: R13 (= R17), R35 (vs. gap), N41 (≠ R38), N97 (≠ H85), D157 (= D140), Q162 (≠ R145), Y170 (= Y153)
- binding methyl 1-(4-{[(2,4-diaminopteridin-6-yl)methyl](methyl)amino}benzoyl)piperidine-4-carboxylate: S100 (= S88), F102 (≠ W90), L164 (≠ S147), Y170 (= Y153)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R17), L14 (≠ I18), H32 (≠ S36), Y33 (= Y37), H34 (vs. gap), R35 (vs. gap), S36 (vs. gap), L62 (≠ F59), N98 (= N86), A99 (= A87), S100 (= S88), S101 (≠ G89), M155 (≠ I138), V156 (≠ T139), K174 (= K157), P200 (= P182), L202 (= L184), S203 (vs. gap)
6gcqA Trypanosoma brucei ptr1 in complex with inhibitor 2b (f192) (see paper)
26% identity, 96% coverage: 10:240/241 of query aligns to 6:248/251 of 6gcqA
- active site: R13 (= R17), D144 (= D140), Y157 (= Y153), K161 (= K157)
- binding 6-(trifluoromethylsulfanyl)-1,3-benzothiazol-2-amine: S94 (= S88), F96 (≠ W90), Y157 (= Y153), L192 (≠ F187), P193 (vs. gap), W204 (≠ Y195)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K12 (≠ R16), R13 (= R17), I14 (= I18), Y33 (= Y37), H34 (≠ R38), N35 (≠ T39), S36 (≠ W40), L62 (≠ F59), N92 (= N86), S94 (= S88), T117 (≠ I109), L142 (≠ I138), K161 (= K157), P187 (= P182), G188 (≠ S183), V189 (≠ L184), S190 (≠ I185), L191 (= L186)
6gcpA Trypanosoma brucei ptr1 in complex with inhibitor 2d (f186) (see paper)
26% identity, 96% coverage: 10:240/241 of query aligns to 6:248/251 of 6gcpA
- active site: R13 (= R17), D144 (= D140), Y157 (= Y153), K161 (= K157)
- binding 6-[(3,4-dichlorophenyl)methylsulfanyl]-1,3-benzothiazol-2-amine: S94 (= S88), F96 (≠ W90), C151 (≠ S147), F154 (≠ H150), Y157 (= Y153), P193 (vs. gap), M196 (vs. gap), W204 (≠ Y195)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R17), I14 (= I18), Y33 (= Y37), H34 (≠ R38), N35 (≠ T39), S36 (≠ W40), D61 (= D58), L62 (≠ F59), N92 (= N86), S94 (= S88), T117 (≠ I109), L142 (≠ I138), K161 (= K157), P187 (= P182), G188 (≠ S183), S190 (≠ I185), L191 (= L186)
6gckA Trypanosoma brucei ptr1 in complex with inhibitor 1e (f206) (see paper)
26% identity, 96% coverage: 10:240/241 of query aligns to 6:248/251 of 6gckA
- active site: R13 (= R17), D144 (= D140), Y157 (= Y153), K161 (= K157)
- binding 4-[(2-azanyl-1,3-benzothiazol-6-yl)oxymethyl]benzenecarbonitrile: S94 (= S88), F96 (≠ W90), C151 (≠ S147), Y157 (= Y153), P193 (vs. gap), M196 (vs. gap), W204 (≠ Y195)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R17), I14 (= I18), Y33 (= Y37), H34 (≠ R38), N35 (≠ T39), S36 (≠ W40), L62 (≠ F59), N92 (= N86), A93 (= A87), S94 (= S88), T117 (≠ I109), L142 (≠ I138), K161 (= K157), P187 (= P182), G188 (≠ S183), S190 (≠ I185), L191 (= L186)
4cm1A Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor (see paper)
26% identity, 96% coverage: 10:240/241 of query aligns to 6:248/251 of 4cm1A
- active site: R13 (= R17), D144 (= D140), Y157 (= Y153), K161 (= K157)
- binding 5-(p-tolyl)-7H-pyrrolo[2,3-d]pyrimidine-2,4-diamine: S94 (= S88), F96 (≠ W90), D144 (= D140), Y157 (= Y153), L192 (≠ F187), P193 (vs. gap), W204 (≠ Y195)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R17), I14 (= I18), H34 (≠ R38), N35 (≠ T39), S36 (≠ W40), D61 (= D58), L62 (≠ F59), N92 (= N86), A93 (= A87), S94 (= S88), T117 (≠ I109), L142 (≠ I138), C143 (≠ T139), K161 (= K157), P187 (= P182), G188 (≠ S183), S190 (≠ I185)
Query Sequence
>BWI76_RS16230 FitnessBrowser__Koxy:BWI76_RS16230
MADIQPRPILITGGGRRIGLALARHFVARQQPVIISYRTWYPAIDALREAGAVCLHADFS
TDESILAFAAEVEAHASGGLRAIIHNASGWMAEKPGIPLTTVLASMMQIHVNAPYLLNHA
LESLLRGHGHAASDIIHITDYVVERGSDKHIAYAASKAALDNMSRSFARKLAPEIKVNAI
APSLILFNEGDDAEYRRQALDKSLMKIAPGEKEIIDLTEYLFSSSYVTGRSFAVDGGRHL
R
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory