Comparing BWI76_RS16585 FitnessBrowser__Koxy:BWI76_RS16585 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5x7uA Trehalose synthase from thermobaculum terrenum (see paper)
39% identity, 89% coverage: 4:486/541 of query aligns to 4:489/546 of 5x7uA
Sites not aligning to the query:
5gtwA The n253r mutant structures of trehalose synthase from deinococcus radiodurans display two different active-site conformations
37% identity, 90% coverage: 3:489/541 of query aligns to 2:499/548 of 5gtwA
3zo9A The structure of trehalose synthase (tres) of mycobacterium smegmatis (see paper)
35% identity, 90% coverage: 2:486/541 of query aligns to 5:496/549 of 3zo9A
3zoaA The structure of trehalose synthase (tres) of mycobacterium smegmatis in complex with acarbose (see paper)
35% identity, 90% coverage: 2:486/541 of query aligns to 4:495/548 of 3zoaA
Sites not aligning to the query:
5ykbD The n253f mutant structure of trehalose synthase from deinococcus radiodurans reveals an open active-site conformation (see paper)
36% identity, 90% coverage: 3:489/541 of query aligns to 2:475/523 of 5ykbD
A0R6E0 Trehalose synthase/amylase TreS; Maltose alpha-D-glucosyltransferase; MTase; EC 3.2.1.1; EC 5.4.99.16 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see 2 papers)
36% identity, 87% coverage: 2:469/541 of query aligns to 33:507/593 of A0R6E0
5jy7B Complex of mycobacterium smegmatis trehalose synthase with maltokinase (see paper)
36% identity, 87% coverage: 2:469/541 of query aligns to 17:491/571 of 5jy7B
3zoaB The structure of trehalose synthase (tres) of mycobacterium smegmatis in complex with acarbose (see paper)
36% identity, 87% coverage: 2:469/541 of query aligns to 17:491/571 of 3zoaB
Sites not aligning to the query:
4lxfA Crystal structure of m. Tuberculosis tres (see paper)
35% identity, 86% coverage: 4:469/541 of query aligns to 32:499/570 of 4lxfA
4lxfB Crystal structure of m. Tuberculosis tres (see paper)
34% identity, 86% coverage: 4:469/541 of query aligns to 32:475/546 of 4lxfB
O06994 Oligo-1,6-glucosidase 1; Dextrin 6-alpha-D-glucanohydrolase; Oligosaccharide alpha-1,6-glucosidase 1; Sucrase-isomaltase 1; Isomaltase 1; EC 3.2.1.10 from Bacillus subtilis (strain 168) (see paper)
28% identity, 91% coverage: 1:494/541 of query aligns to 1:522/561 of O06994
5wczA Crystal structure of wild-type mall from bacillus subtilis with ts analogue 1-deoxynojirimycin (see paper)
28% identity, 91% coverage: 3:494/541 of query aligns to 1:517/556 of 5wczA
4m56A The structure of wild-type mall from bacillus subtilis (see paper)
28% identity, 91% coverage: 3:494/541 of query aligns to 1:517/555 of 4m56A
4mazA The structure of mall mutant enzyme v200s from bacillus subtilus (see paper)
28% identity, 91% coverage: 3:494/541 of query aligns to 1:520/559 of 4mazA
7lv6B The structure of mall mutant enzyme s536r from bacillus subtilis
28% identity, 91% coverage: 3:494/541 of query aligns to 1:520/559 of 7lv6B
4aieA Structure of glucan-1,6-alpha-glucosidase from lactobacillus acidophilus ncfm (see paper)
26% identity, 92% coverage: 2:501/541 of query aligns to 1:511/537 of 4aieA
8ibkA Crystal structure of bacillus sp. Ahu2216 gh13_31 alpha-glucosidase e256q/n258g in complex with maltotriose (see paper)
27% identity, 90% coverage: 4:492/541 of query aligns to 3:507/546 of 8ibkA
Sites not aligning to the query:
5do8B 1.8 angstrom crystal structure of listeria monocytogenes lmo0184 alpha-1,6-glucosidase (see paper)
25% identity, 92% coverage: 2:497/541 of query aligns to 2:518/553 of 5do8B
3wy2A Crystal structure of alpha-glucosidase in complex with glucose (see paper)
32% identity, 74% coverage: 4:405/541 of query aligns to 4:419/535 of 3wy2A
3wy1A Crystal structure of alpha-glucosidase (see paper)
32% identity, 74% coverage: 4:405/541 of query aligns to 4:419/535 of 3wy1A
>BWI76_RS16585 FitnessBrowser__Koxy:BWI76_RS16585
MADWHTRAIIYQIDSALFYDFNSDGCGDIAGITAKLRYIRRMGATVIWITPFYLTPFLDE
GYDVSDHLQVDPRFGQLADIIAFIEQARELGMQVIIELLIQHTSDAHPWFQRARRSRSSP
FRDYYLWADSDDDDTPPMFPGVEESIWTWDEEAGQYFRHMFYRHEPDLNLASPAVIKEVE
NIIIFWLKLGVSGFRLDAAAHLTKQAGRGEEKRGLWILEHLRRLVERHNPQAILLGEVDV
DVEQYRDYFGDNNRLNMVLNFWLNKYFYVSLASQNARPLINAIKKTIVPPDACCFANWLR
NHDELDLEGIGNKNKQTVLEAFAPDEKMNVYQRGIRRRLAPMLNGNRQRLAFCHAVLFSL
PGVPIMRYGDEIGMGDDLALEERYAVRTPMQWAGSAGGGFSAADPDTFVAPMIDRGPFRY
QKVNVADSLLHRHSLLHRIMDIANTRSEFPEIAVAPFRIISTDRQAILAICYDNHERSVI
TFLNFSEKALRFTAKGIDEAVWTPCLADKTYADALIPGKRVELEISAYGYRWFWTNSSAL
R
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory