Comparing BWI76_RS17225 FitnessBrowser__Koxy:BWI76_RS17225 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
41% identity, 89% coverage: 17:317/337 of query aligns to 2:303/326 of Q8RDH4
Sites not aligning to the query:
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
40% identity, 89% coverage: 17:317/337 of query aligns to 1:292/310 of 4fwiB
Sites not aligning to the query:
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
38% identity, 94% coverage: 19:334/337 of query aligns to 3:326/330 of P0AAH4
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
36% identity, 69% coverage: 40:272/337 of query aligns to 20:247/253 of 7z15I
Sites not aligning to the query:
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
36% identity, 69% coverage: 40:272/337 of query aligns to 20:247/250 of 7z18I
Sites not aligning to the query:
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
35% identity, 69% coverage: 40:272/337 of query aligns to 20:247/250 of 7z16I
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
31% identity, 75% coverage: 19:272/337 of query aligns to 3:241/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
31% identity, 75% coverage: 19:272/337 of query aligns to 3:241/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
31% identity, 75% coverage: 19:272/337 of query aligns to 3:241/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
31% identity, 75% coverage: 19:272/337 of query aligns to 3:241/242 of 2oljA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 78% coverage: 19:280/337 of query aligns to 1:252/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
31% identity, 78% coverage: 19:280/337 of query aligns to 2:253/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
31% identity, 78% coverage: 19:280/337 of query aligns to 2:253/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
31% identity, 78% coverage: 19:280/337 of query aligns to 2:253/344 of 3tuiC
8g4cB Bceabs atpgs high res tm (see paper)
30% identity, 72% coverage: 18:259/337 of query aligns to 2:237/248 of 8g4cB
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
34% identity, 62% coverage: 19:228/337 of query aligns to 3:202/226 of 5xu1B
7tchB Bceab e169q variant atp-bound conformation (see paper)
30% identity, 72% coverage: 18:259/337 of query aligns to 1:236/245 of 7tchB
Q5M243 Energy-coupling factor transporter ATP-binding protein EcfA1; ECF transporter A component EcfA1; EC 7.-.-.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
30% identity, 74% coverage: 19:268/337 of query aligns to 1:236/276 of Q5M243
5d3mA Folate ecf transporter: amppnp bound state (see paper)
32% identity, 72% coverage: 26:268/337 of query aligns to 10:242/280 of 5d3mA
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
30% identity, 69% coverage: 34:264/337 of query aligns to 37:258/382 of 7ahhC
Sites not aligning to the query:
>BWI76_RS17225 FitnessBrowser__Koxy:BWI76_RS17225
MSTMETAKAPQAAQQSGLLLDVKDLRVTFGTPDGDVTAVNDLNFNLRAGETLGIVGESGS
GKSQTAFALMGLLAANGRIGGSATFNGKQILNLPERELNKLRAEQISMIFQDPMTSLNPY
MRVGEQLMEVLMLHKALSKAEAFEESVKMLDAVKMPEARKRMKMYPHEFSGGMRQRVMIA
MALLCRPKLLIADEPTTALDVTVQAQIMTLLNELKREFNTAIIMITHDLGVVAGICDKVL
VMYAGRTMEYGQARDVFYQPSHPYSIGLLNAVPRLDAEGDALLTIPGNPPNLLRLPKGCP
FQPRCPHAMEICNSAPPLEEFAPGRLRACFQPVGDLL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory