Comparing BWI76_RS17240 FitnessBrowser__Koxy:BWI76_RS17240 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2rkmA Structure of oppa complexed with lys-lys (see paper)
90% identity, 95% coverage: 27:543/543 of query aligns to 1:517/517 of 2rkmA
1olcA Oligo-peptide binding protein (oppa) complexed with lys-lys- lys-ala (see paper)
90% identity, 95% coverage: 27:543/543 of query aligns to 1:517/517 of 1olcA
1b05A Structure of oligo-peptide binding protein complexed with lys-cys-lys (see paper)
90% identity, 95% coverage: 27:543/543 of query aligns to 1:517/517 of 1b05A
3tcfA Crystal structure of e. Coli oppa complexed with endogenous ligands (see paper)
86% identity, 95% coverage: 27:543/543 of query aligns to 1:517/517 of 3tcfA
2z23A Crystal structure of y.Pestis oligo peptide binding protein oppa with tri-lysine ligand (see paper)
80% identity, 95% coverage: 27:543/543 of query aligns to 1:517/517 of 2z23A
6dtgA Crystal structure of haemophilus influenzae oppa complex with ylgangrgggs (see paper)
55% identity, 95% coverage: 29:543/543 of query aligns to 4:522/522 of 6dtgA
3o9pA The structure of the escherichia coli murein tripeptide binding protein mppa (see paper)
50% identity, 94% coverage: 35:543/543 of query aligns to 3:509/509 of 3o9pA
3zs6A The structural characterization of burkholderia pseudomallei oppa. (see paper)
45% identity, 94% coverage: 35:542/543 of query aligns to 1:506/506 of 3zs6A
4gl8A X-ray crystal structure of a periplasmic oligopeptide-binding protein/oligopeptide abc transporter(oppaiv) from borrelia burgdorferi
35% identity, 83% coverage: 44:496/543 of query aligns to 7:454/500 of 4gl8A
8arnA Crystal structure of the peptide binding protein, oppa, from bacillus subtilis in complex with an endogenous tetrapeptide (see paper)
35% identity, 88% coverage: 38:513/543 of query aligns to 3:482/509 of 8arnA
P24141 Oligopeptide-binding protein OppA; Stage 0 sporulation protein KA from Bacillus subtilis (strain 168) (see paper)
35% identity, 88% coverage: 38:513/543 of query aligns to 39:518/545 of P24141
8ay0B Crystal structure of the peptide binding protein dppe from bacillus subtilis in complex with murein tripeptide (see paper)
32% identity, 90% coverage: 38:523/543 of query aligns to 1:479/496 of 8ay0B
6npoA Crystal structure of oligopeptide abc transporter from bacillus anthracis str. Ames (substrate-binding domain)
31% identity, 90% coverage: 34:523/543 of query aligns to 2:499/518 of 6npoA
5kztB Listeria monocytogenes oppa bound to peptide
31% identity, 93% coverage: 38:542/543 of query aligns to 4:509/510 of 5kztB
4fajA Structure and mode of peptide binding of pheromone receptor prgz (see paper)
28% identity, 87% coverage: 46:518/543 of query aligns to 10:483/507 of 4fajA
8upiA Structure of a periplasmic peptide binding protein from mesorhizobium sp. Ap09 bound to aminoserine
32% identity, 56% coverage: 48:350/543 of query aligns to 12:312/510 of 8upiA
Sites not aligning to the query:
6ofqA Abc transporter-associated periplasmic binding protein dppa from helicobacter pylori in complex with peptide stsa (see paper)
27% identity, 87% coverage: 40:510/543 of query aligns to 11:481/512 of 6ofqA
7kz9A Crystal structure of pseudomonas sp. Pdc86 substrate-binding protein aapf in complex with a signaling molecule heheaa (see paper)
26% identity, 79% coverage: 85:513/543 of query aligns to 49:453/478 of 7kz9A
Sites not aligning to the query:
P23847 Dipeptide-binding protein; DBP; Periplasmic dipeptide transport protein from Escherichia coli (strain K12) (see 4 papers)
25% identity, 99% coverage: 1:540/543 of query aligns to 1:534/535 of P23847
1dppA Dipeptide binding protein complex with glycyl-l-leucine (see paper)
26% identity, 84% coverage: 83:540/543 of query aligns to 47:506/507 of 1dppA
Sites not aligning to the query:
>BWI76_RS17240 FitnessBrowser__Koxy:BWI76_RS17240
MTIITKKSLVAAGVLSALMTINAAVAADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGV
PESNINRDLFEGLLVSDLDGHPVAGVAEKWDNKDFKVWTFHLRKDAKWSDGTPVTAQDFV
YSWQRLADPKTASPYASYLQYGHLANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPY
FYKLLVHPSVSPVPKSAIEKFGDKWTQPANIVSNGAYKLKDWVVNERIVLERNTNYWDNA
KTVINQVTFLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPKEVHVDPYLCTYY
YEINNQKAPFTDVRVRTALKMALDRDIIVNKVKNQGDLPAYSYTPPYTDGMKLIEPEWFK
WSQEKRNEEAKKLLAEAGYSADKPLTFNLLYNTSDLHKKLAIAVASIWKKNLGVNVKLEN
QEWKTFLDNRHQGTFDIARAGWCADYNEPTSFLNTMLSDSSNNTSHYKSPAFDKIIAETL
KTSDEGKRADLYAQSEQQLDKDSVIVPVFYYVNARLVKPWVGGYTGKDPLDNTYTRNMYI
VKH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory