Comparing BWI76_RS18250 FitnessBrowser__Koxy:BWI76_RS18250 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
5abpA Substrate specificity and affinity of a protein modulated by bound water molecules (see paper)
92% identity, 93% coverage: 25:326/326 of query aligns to 1:302/305 of 5abpA
1abfA Substrate specificity and affinity of a protein modulated by bound water molecules (see paper)
92% identity, 93% coverage: 25:326/326 of query aligns to 1:302/305 of 1abfA
1abeA Novel stereospecificity of the l-arabinose-binding protein (see paper)
92% identity, 93% coverage: 25:326/326 of query aligns to 1:302/305 of 1abeA
4kzkA The structure of the periplasmic l-arabinose binding protein from burkholderia thailandensis
47% identity, 92% coverage: 26:326/326 of query aligns to 1:301/301 of 4kzkA
5ibqA Crystal structure of an abc solute binding protein from rhizobium etli cfn 42 (rhe_pf00037,target efi-511357) in complex with alpha-d-apiose
23% identity, 86% coverage: 36:316/326 of query aligns to 13:277/287 of 5ibqA
4ry0A Crystal structure of ribose transporter solute binding protein rhe_pf00037 from rhizobium etli cfn 42, target efi-511357, in complex with d-ribose
23% identity, 86% coverage: 36:316/326 of query aligns to 13:277/287 of 4ry0A
P23905 D-galactose/methyl-galactoside binding periplasmic protein MglB; D-galactose-binding periplasmic protein; GBP; D-galactose/D-glucose-binding protein; GGBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
25% identity, 90% coverage: 1:292/326 of query aligns to 1:294/332 of P23905
5kwsA Crystal structure of galactose binding protein from yersinia pestis in the complex with beta d glucose
26% identity, 70% coverage: 65:292/326 of query aligns to 44:271/307 of 5kwsA
Sites not aligning to the query:
P0AEE5 D-galactose/methyl-galactoside binding periplasmic protein MglB; D-galactose-binding periplasmic protein; GBP; D-galactose/D-glucose-binding protein; GGBP from Escherichia coli (strain K12) (see 4 papers)
24% identity, 90% coverage: 1:292/326 of query aligns to 1:294/332 of P0AEE5
3ga5A X-ray structure of glucose/galactose receptor from salmonella typhimurium in complex with (2r)-glyceryl-beta-d-galactopyranoside (see paper)
26% identity, 70% coverage: 65:292/326 of query aligns to 42:269/305 of 3ga5A
Sites not aligning to the query:
1gcaA The 1.7 angstroms refined x-ray structure of the periplasmic glucose(slash)galactose receptor from salmonella typhimurium (see paper)
26% identity, 70% coverage: 65:292/326 of query aligns to 44:271/309 of 1gcaA
Sites not aligning to the query:
8fxtA Escherichia coli periplasmic glucose-binding protein glucose complex: acrylodan conjugate attached at w183c (see paper)
26% identity, 70% coverage: 65:292/326 of query aligns to 43:270/305 of 8fxtA
Sites not aligning to the query:
2qw1A Glucose/galactose binding protein bound to 3-o-methyl d-glucose (see paper)
26% identity, 70% coverage: 65:292/326 of query aligns to 43:270/305 of 2qw1A
2gbpA Sugar and signal-transducer binding sites of the escherichia coli galactose chemoreceptor protein (see paper)
26% identity, 70% coverage: 65:292/326 of query aligns to 44:271/309 of 2gbpA
Sites not aligning to the query:
>BWI76_RS18250 FitnessBrowser__Koxy:BWI76_RS18250
MHKFTKALAAIGLAAVMSQSAMAETLKLGFLVKQPEEPWFQTEWKFADKAGKDLGFDVIK
IAVPDGEKTLNAIDSLAASGAKGFVICTPDPKLGAAIVAKARGYDMKVITVDDQFVNAKG
KPMDSVPLVMMAASEIGARQGQELYKEMQKRGWDVKDTAVMAITADELDTARRRTTGSID
ALKAAGFPEQQIYRVPTKSNDIPGAFDAGNSMLVQHPNVKHWLIVGMNDNTVLGGVRATE
GQGFKAPDVIGIGINGVDAVNELSKAQATGFYGSLLPSPDIHGYKTSEMLYNWVTKDVEP
PKFTAVTDVVLITRDNFKEELAKKGL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory