SitesBLAST
Comparing BWI76_RS19590 FitnessBrowser__Koxy:BWI76_RS19590 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
100% identity, 100% coverage: 1:452/452 of query aligns to 1:452/452 of Q5EXK5
- D82 (= D82) mutation to A: Loss of activity.
- V311 (= V311) mutation to W: Loss of activity.
- D314 (= D314) mutation to A: Loss of activity.
Q51955 4-hydroxybenzoate transporter PcaK from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
42% identity, 94% coverage: 3:429/452 of query aligns to 10:438/448 of Q51955
- D41 (= D34) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- D44 (= D37) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- G85 (= G78) mutation to V: Abolishes 4-HBA transport and chemotaxis.
- D89 (= D82) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- G92 (= G85) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to C: No change in 4-HBA transport and chemotaxis.; mutation G->L,V: Abolishes 4-HBA transport and chemotaxis.; mutation to Q: Decrease in 4-HBA transport and strong decrease in chemotaxis.
- R124 (= R117) mutation to A: Abolishes 4-HBA transport.
- E144 (= E137) mutation to A: Strong decrease in 4-HBA transport.
- H183 (= H176) mutation to A: Decrease in 4-HBA transport and chemotaxis.
- D323 (= D314) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- H328 (≠ Y319) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to R: Decrease in 4-HBA transport and loss of chemotaxis.
- R386 (= R377) mutation to A: Strong decrease in 4-HBA transport.
- R398 (= R389) mutation to A: Abolishes 4-HBA transport.
Sites not aligning to the query:
- 444 H→A: No change in 4-HBA transport and chemotaxis.
P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
39% identity, 84% coverage: 27:406/452 of query aligns to 20:366/403 of P77589
- E27 (≠ D34) mutation to A: Lack of 3HPP transport activity.; mutation to D: Slight decrease in 3HPP transport activity.
- D75 (= D82) mutation D->A,E: Lack of 3HPP transport activity.
- A272 (≠ V311) mutation to H: 30% increase in 3HPP transport activity.
- K276 (≠ R315) mutation to D: Lack of 3HPP transport activity.
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
27% identity, 91% coverage: 2:413/452 of query aligns to 23:410/444 of Q8NLB7
- D54 (= D34) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- D57 (= D37) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- R103 (= R83) mutation to A: Loss of transport activity.
- W309 (≠ V311) mutation to V: Loss of transport activity.
- D312 (= D314) mutation to A: Loss of transport activity.
- R313 (= R315) mutation to A: Loss of transport activity.
- I317 (≠ Y319) mutation I->H,Y: Loss of transport activity.
- R386 (= R389) mutation to A: Loss of transport activity.
Q02563 Synaptic vesicle glycoprotein 2A; Synaptic vesicle protein 2; Synaptic vesicle protein 2A from Rattus norvegicus (Rat) (see 2 papers)
23% identity, 62% coverage: 6:283/452 of query aligns to 151:474/742 of Q02563
- DMCLS 196:200 (≠ HWQLT 51:55) mutation Missing: No change in uptake of C.botulinum neurotoxin type D (BoNT/D, botD) or C.botulinum neurotoxin type E (BoNT/E).
- 321:331 (vs. 176:176, 9% identical) mutation Missing: No change in uptake of BoNT/D or BoNT/E.
Sites not aligning to the query:
- 498 N→Q: No change in uptake of BoNT/E or C.botulinum neurotoxin type A (BoNT/A, botA) by mouse SV2A/SV2B knockout neurons; SV2A apparent molecular weight decreases. No change in uptake of BoNT/E; when associated with Q-548. No change in uptake of BoNT/D.
- 548 N→Q: No change in uptake of BoNT/E or BoNT/A by mouse SV2A/SV2B knockout neurons; SV2A apparent molecular weight decreases. No change in uptake of BoNT/E; when associated with Q-498. No change in uptake of BoNT/D.
- 570:573 RLVN→TLVQ: Restores apparent molecular weight to wild-type, does not restore uptake of BoNT/E.
- 573 N→Q: BoNT/E not taken up by mouse SV2A/SV2B knockout neurons, decreased uptake of BoNT/A; SV2A apparent molecular weight decreases. No change in uptake of BoNT/D.
O76082 Organic cation/carnitine transporter 2; High-affinity sodium-dependent carnitine cotransporter; Solute carrier family 22 member 5 from Homo sapiens (Human) (see 21 papers)
27% identity, 80% coverage: 33:395/452 of query aligns to 114:477/557 of O76082
- D115 (= D34) to G: in CDSP; carnitine transport reduced to less than 5% of wild-type; dbSNP:rs386134192
- V123 (≠ G42) to G: in CDSP; carnitine transport reduced to less than 20% of wild-type; dbSNP:rs748605096
- E131 (≠ H51) to D: in CDSP; uncertain significance; may affect splicing; reduces carnitine transport but the mutant retains 30% of wild-type activity
- A142 (= A60) to S: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 25% of wild-type activity; dbSNP:rs151231558
- P143 (= P61) to L: in CDSP; carnitine transport reduced to less than 2% of wild-type; dbSNP:rs1178584184
- L144 (= L62) to F: in dbSNP:rs10040427
- V151 (≠ L68) to M: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 60% of wild-type activity; dbSNP:rs386134193
- R169 (= R86) to P: in CDSP; loss of carnitine transport; to Q: in CDSP; loss of carnitine transport; dbSNP:rs121908889; to W: in CDSP; loss of carnitine transport; dbSNP:rs121908890
- V175 (≠ F92) to M: in CDSP; carnitine transport reduced to less than 10% of wild-type; dbSNP:rs781721860
- M177 (≠ V94) to V: in CDSP; carnitine transport reduced to less than 20% of wild-type; dbSNP:rs145068530
- M179 (≠ L96) to L: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 40% of wild-type activity; dbSNP:rs386134196
- L186 (= L103) to P: in CDSP; loss of carnitine transport; dbSNP:rs386134197
- M205 (≠ L122) to R: in CDSP; loss of carnitine transport; dbSNP:rs796052033
- N210 (≠ A127) to S: in CDSP; loss of carnitine transport; dbSNP:rs386134198
- Y211 (≠ M128) to C: in CDSP; loss of carnitine transport; dbSNP:rs121908888
- A214 (≠ T131) to V: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 30% of wild-type activity; dbSNP:rs386134199
- T219 (≠ S136) to K: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 30% of wild-type activity
- S225 (≠ R142) to L: in CDSP; reduces carnitine transport to less than 20% of wild-type activity; dbSNP:rs386134205
- R227 (= R144) to H: in CDSP; reduces carnitine transport to less than 10% of wild-type activity; dbSNP:rs185551386
- F230 (≠ L147) to L: in CDSP; reduces carnitine transport to less than 1% of wild-type activity; dbSNP:rs756650860
- S231 (≠ V148) to F: in CDSP; loss of carnitine transport; dbSNP:rs386134206
- T232 (= T149) to M: in CDSP; reduces carnitine transport to less than 20% of wild-type activity; dbSNP:rs114269482
- A240 (= A160) to T: in CDSP; reduces carnitine transport to less than 2% of wild-type activity
- G242 (= G162) to V: in CDSP; loss of carnitine transport; dbSNP:rs72552728
- P247 (≠ A167) to R: in CDSP; loss of carnitine transport
- R254 (≠ G174) to Q: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 30% of wild-type activity; dbSNP:rs200699819
- R257 (≠ G177) to W: in CDSP; reduces carnitine transport to less than 10% of wild-type activity; dbSNP:rs386134203
- T264 (≠ V184) to M: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 40% of wild-type activity; dbSNP:rs201262157; to R: in CDSP; reduces carnitine transport to less than 5% of wild-type activity; dbSNP:rs201262157
- L269 (= L189) to P: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 40% of wild-type activity
- S280 (= S200) to F: in CDSP; reduces carnitine transport to less than 1% of wild-type activity; dbSNP:rs386134208
- R282 (= R202) to Q: in CDSP; reduces carnitine transport to 5% of wild-type activity; dbSNP:rs386134210
- W283 (= W203) to C: in CDSP; loss of carnitine transport; dbSNP:rs386134211; to R: in CDSP; reduces carnitine transport to less than 1% of wild-type activity; dbSNP:rs72552729
- A301 (≠ G219) to D: in CDSP; reduces carnitine transport to less-than-1% to 3% of wild-type activity; dbSNP:rs72552730
- I312 (≠ H230) to V: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 70% of wild-type activity; dbSNP:rs77300588
- E317 (≠ A238) to K: in CDSP; uncertain significance; no effect on carnitine transport; dbSNP:rs774792831
- I348 (= I270) to T: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 60% of wild-type activity; dbSNP:rs150544263
- W351 (= W276) to R: in CDSP; loss of carnitine transport; dbSNP:rs68018207
- M352 (= M277) mutation to R: Loss of both carnitine and organic cation transport functionalities. No effect on protein expression.
- S355 (≠ L280) to L: in CDSP; reduces carnitine transport to less than 2% of wild-type activity; dbSNP:rs1385634398
- Y358 (≠ H283) to N: in CDSP; loss of carnitine transport; dbSNP:rs61731073
- L363 (= L288) to P: in CDSP; loss of carnitine transport; dbSNP:rs386134214
- L394 (≠ D314) natural variant: Missing (in CDSP; reduces carnitine transport to 5% of wild-type activity)
- P398 (= P318) to L: in CDSP; reduces carnitine transport to less than 1% of wild-type activity; dbSNP:rs144547521
- R399 (≠ Y319) to Q: in CDSP; carnitine transport is reduced to less than 1% of normal; dbSNP:rs121908891; to W: in CDSP; reduces carnitine transport to less than 5% of wild-type activity; dbSNP:rs267607054
- S412 (≠ V331) to G: in CDSP; uncertain significance; no effect on carnitine transport
- V439 (≠ I357) to G: in CDSP; reduces carnitine transport to less than 1% of wild-type activity
- T440 (≠ S358) to M: in CDSP; loss of carnitine transport; dbSNP:rs72552732
- A442 (≠ S360) to I: in CDSP; reduces carnitine transport to less than 20% of wild-type activity; requires 2 nucleotide substitutions; dbSNP:rs267607053
- F443 (≠ Q361) to V: in CDSP; reduces carnitine transport to less than 1% of wild-type
- V446 (≠ L364) to F: in CDSP; reduces carnitine transport to less than 1% of wild-type; dbSNP:rs72552733
- Y447 (≠ N365) to C: in CDSP; loss of carnitine transport; dbSNP:rs386134218
- V448 (≠ A366) to L: in CDSP; reduces carnitine transport to less than 20% of wild-type; dbSNP:rs386134219
- Y449 (≠ L367) to D: in CDSP; uncertain significance; reduces carnitine transport to less than 20% of wild-type; dbSNP:rs11568514
- E452 (≠ T370) to K: in CDSP; reduces carnitine transport to less than 5% of wild-type; dbSNP:rs72552734
- P455 (= P373) to R: in CDSP; loss of carnitine transport; dbSNP:rs1408166345
- G462 (= G380) to V: in CDSP; reduces carnitine transport to less than 5% of wild-type
- S467 (≠ N385) to C: in CDSP; reduces carnitine transport to less than 20% of wild-type activity; dbSNP:rs60376624
- T468 (≠ A386) to R: in CDSP; markedly reduced carnitine transport compared to the wild-type protein; less than 1% of wild-type activity; dbSNP:rs386134221
- S470 (≠ G388) to F: in CDSP; loss of carnitine transport; dbSNP:rs386134222
- R471 (= R389) to H: in CDSP; reduces carnitine transport to less than 2% of wild-type; dbSNP:rs386134223; to P: in CDSP; loss of carnitine transport
- L476 (≠ V394) to R: in CDSP; loss of carnitine transport
Sites not aligning to the query:
- 12 G → S: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 50% of wild-type activity; dbSNP:rs139203363
- 15 G → W: in CDSP; carnitine transport reduced to less than 20% of wild-type; dbSNP:rs267607052
- 16 P → L: in CDSP; loss of carnitine transport
- 17 F → L: in CDSP; carnitine transport reduced to less than 20% of wild-type; dbSNP:rs11568520
- 19 R → P: in CDSP; carnitine transport is reduced to less than 5% of normal; dbSNP:rs72552723
- 20 L → H: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 50% of wild-type activity; dbSNP:rs144020613
- 22 natural variant: Missing (in CDSP; reduces carnitine transport to less than 1% of normal)
- 26 S → N: in CDSP; carnitine transport reduced to less than 6% of wild-type; dbSNP:rs772578415
- 28 S → I: in CDSP; carnitine transport reduced to 1% of wild-type; dbSNP:rs72552724
- 32 N → S: in CDSP; carnitine transport reduced to less than 1% of wild-type; dbSNP:rs72552725
- 44 A → V: in CDSP; carnitine transport reduced to less than 10% of wild-type; dbSNP:rs199689597
- 46 P → L: in CDSP; carnitine transport reduced to less than 5% of wild-type; dbSNP:rs377767445; P → S: in CDSP; carnitine transport is reduced to less than 5% of normal; dbSNP:rs202088921
- 50 C → Y: in CDSP; loss of carnitine transport
- 57 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 66 T → P: in CDSP; carnitine transport reduced to 2% of wild-type
- 75 R → P: in CDSP; carnitine transport reduced to 2% of wild-type; dbSNP:rs757711838
- 83 R → L: in CDSP; loss of carnitine transport; dbSNP:rs72552726
- 91 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Reduces expression to 50%. No effect on carnitine transporter activity.
- 93 S → W: in CDSP; loss of carnitine transport; dbSNP:rs386134190
- 95 L → V: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 30% of wild-type activity; dbSNP:rs386134191
- 96 G → A: in CDSP; carnitine transport reduced to 20% of wild-type; dbSNP:rs377767450
- 478 P → L: in CDSP; loss of carnitine transport but stimulated organic cation transport; no effect on protein expression; dbSNP:rs72552735
- 481 V → F: reduces carnitine transport but the mutant retains more than 60% of wild-type activity; dbSNP:rs11568513; V → I: in dbSNP:rs11568513
- 488 R → C: in CDSP; reduces carnitine transport to less than 10% of wild-type; dbSNP:rs377216516; R → H: in CDSP; uncertain significance; reduces carnitine transport to 40% of wild-type; dbSNP:rs28383481
- 507 L → S: in CDSP; reduces carnitine transport to 5% of wild-type; dbSNP:rs1157198543
- 508 F → L: in dbSNP:rs11568521
- 530 M → V: in dbSNP:rs11568524
- 549 P → S: reduces carnitine transport but the mutant retains more than 20% of wild-type activity; dbSNP:rs11568525
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
29% identity, 47% coverage: 34:246/452 of query aligns to 23:225/446 of A0A0H2VG78
- R102 (= R117) mutation to A: Loss of transport activity.
- I105 (≠ T120) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (= E137) mutation to A: Loss of transport activity.
- Q137 (≠ F152) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 22 D→N: Affects symport activity. May function as an uniporter.
- 250 Q→A: Loss of transport activity.
- 251 Q→A: Loss of transport activity.
- 256 N→A: Loss of transport activity.
- 357 W→A: Loss of transport activity.
Q496J9 Synaptic vesicle glycoprotein 2C from Homo sapiens (Human) (see 4 papers)
29% identity, 30% coverage: 68:203/452 of query aligns to 199:346/727 of Q496J9
Sites not aligning to the query:
- 519:563 (Microbial infection) C.botulinum neurotoxin type A-binding
- 534 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 559 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: No change in interaction with C.botulinum neurotoxin type A heavy chain (botA, BoNT/A HC). Decreased molecular weight probably due to glycosylation loss, decreased interaction with BoNT/A HC.; N→Q: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC. Greater reduction in weight; when associated with Q-565.
- 561 S→A: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC.
- 563 F→A: No longer interacts with BoNT/A HC.
- 565 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Decreased molecular weight probably due to glycosylation loss, no change in binding to BoNT/A heavy chain. Greater reduction in weight; when associated with Q-559.
Q9Z2I6 Synaptic vesicle glycoprotein 2C; Synaptic vesicle protein 2C from Rattus norvegicus (Rat) (see 3 papers)
28% identity, 30% coverage: 68:203/452 of query aligns to 199:346/727 of Q9Z2I6
Sites not aligning to the query:
- 1:57 Interaction with SYT1
- 529:566 (Microbial infection) C.botulinum neurotoxin type A-binding
- 559 N→A: Loss of one glycosylation site. No effect on C.botulinum neurotoxin type A (BoNT/A, botA) binding, but reduces the uptake of BoNT/A.
Q4U2R8 Solute carrier family 22 member 6; Organic anion transporter 1; hOAT1; PAH transporter; hPAHT; Renal organic anion transporter 1; hROAT1 from Homo sapiens (Human) (see 6 papers)
26% identity, 80% coverage: 67:429/452 of query aligns to 142:504/563 of Q4U2R8
- Y230 (≠ F155) mutation to A: Loss of membrane protein expression and little uptake of cidofovir.
- K431 (≠ T353) mutation to A: Decrease in the level of membrane protein expression and 70 % loss of PAH uptake.
- F438 (≠ Q361) mutation to A: Decrease in the level of membrane protein expression, 70 % loss of PAH uptake, increased affinity for cidofovir, lower Vmax for PAH, and lower Km and Vmax for cidofovir.
Sites not aligning to the query:
- 7 L → P: in dbSNP:rs1415632329
- 30 L→A: Complete loss of PAH transport activity.
- 36 T→A: Complete loss of PAH transport activity.
- 39 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Complete loss of PAH transport activity.
- 50 R → H: lower Vmax; increase in substrate affinity and increase in the affinity for the nucleoside phosphonate analogs cidofovir, adefovir and tenofovir; dbSNP:rs11568626
- 56 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 92 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 97 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 104 P → L: in dbSNP:rs11568627
- 113 modified: carbohydrate, N-linked (GlcNAc...) asparagine
8bw7A Cryo-em structure of rat slc22a6 bound to alpha-ketoglutaric acid (see paper)
27% identity, 80% coverage: 67:429/452 of query aligns to 124:476/497 of 8bw7A
8bvtA Cryo-em structure of rat slc22a6 bound to probenecid (see paper)
26% identity, 80% coverage: 67:429/452 of query aligns to 133:489/508 of 8bvtA
Sites not aligning to the query:
8bvsA Cryo-em structure of rat slc22a6 bound to tenofovir (see paper)
26% identity, 80% coverage: 67:429/452 of query aligns to 124:480/502 of 8bvsA
Q9NSA0 Solute carrier family 22 member 11; Organic anion transporter 4; OAT4; Organic anion:dicarboxylate exchanger OAT4 from Homo sapiens (Human) (see 3 papers)
28% identity, 77% coverage: 48:397/452 of query aligns to 128:481/550 of Q9NSA0
- G241 (= G158) mutation G->L,S,V: Strongly reduced cell surface expression and estrone 3-sulfate transport.
- H305 (≠ E224) mutation to A: Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-47; A-52; A-83 and A-469.
- G400 (≠ M313) mutation G->L,S,V: Strongly reduced cell surface expression and estrone 3-sulfate transport.
- H469 (≠ N385) mutation to A: Slightly reduced estrone 3-sulfate transport. Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-47; A-52; A-83 and A-305.
Sites not aligning to the query:
- 39 N→Q: No visible effect on N-glycosylation. Loss of N-glycosylation and of cell surface location; when associated with Q-56; Q-63 and Q-99.
- 47 H→A: Reduced cell surface expression and estrone 3-sulfate transport. Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-52; A-83; A-305 and A-469.
- 52 H→A: Slightly reduced estrone 3-sulfate transport. Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-47; A-83; A-305 and A-469.
- 56 N→Q: No visible effect on N-glycosylation. Loss of N-glycosylation and of cell surface expression; when associated with Q-39; Q-63 and Q-99.
- 63 N→Q: No visible effect on N-glycosylation. Loss of N-glycosylation and of cell surface expression; when associated with Q-39; Q-56 and Q-99.
- 83 H→A: Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-47; A-52; A-305 and A-469.
- 99 N→Q: No visible effect on N-glycosylation. Loss of N-glycosylation and of cell surface expression; when associated with Q-39; Q-56 and Q-63.
Q8VC69 Solute carrier family 22 member 6; Kidney-specific transport protein; Novel kidney transcript; mNKT; Organic anion transporter 1; mOAT1; Renal organic anion transporter 1; mROAT1 from Mus musculus (Mouse) (see 2 papers)
27% identity, 80% coverage: 67:429/452 of query aligns to 136:498/545 of Q8VC69
- C183 (≠ V114) mutation to A: Decreased cell surface expression level and PAH transport activity. Complete loss of PAH transport activity; when associated with A-49; A-78; A-99; A-122; A-172; A-200; A-362; A-335; A-379; A-402; A-427 and A-434.
- C434 (≠ G363) mutation to A: Decreased cell surface expression level and PAH transport activity. 80% decrease of PAH transport activity; when associated with A-49; A-122 and A-183. Complete loss of PAH transport activity; when associated with A-49; A-78; A-99; A-122; A-172; A-183; A-200; A-362; A-335; A-379; A-402 and A-427.
Sites not aligning to the query:
- 39 N→Q: Complete loss of PAH transport activity.
- 49 C→A: Decreased cell surface expression level and PAH transport activity. Complete loss of PAH transport activity; when associated with A-78; A-99; A-122; A-172; A-183; A-200; A-362; A-335; A-379; A-402; A-427 and A-434.
- 56 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 86 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 91 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 107 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 122 C→A: Decreased cell surface expression level and PAH transport activity. Complete loss of PAH transport activity; when associated with A-49; A-78; A-99; A-172; A-183; A-200; A-362; A-335; A-379; A-402; A-427 and A-434.
Q63089 Solute carrier family 22 member 1; Organic cation transporter 1; rOCT1 from Rattus norvegicus (Rat) (see 4 papers)
27% identity, 77% coverage: 47:393/452 of query aligns to 134:479/556 of Q63089
- C155 (≠ G66) mutation to A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-179; S-322; A-358; A-418; S-437; A-470 and A-474.
- C179 (≠ V89) mutation to A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; S-322; A-358; A-418; S-437; A-470 and A-474.
- M212 (≠ L122) mutation to L: No change in TEA and MPP(+) uptake.
- V213 (≠ G123) mutation to G: Decreased TEA uptake. No change in MPP(+) uptake.
- S214 (≠ L124) mutation to G: Decreased TEA and MPP(+) uptake.
- K215 (≠ G125) mutation to Q: Loss of TEA and MPP(+) uptake activity.; mutation to R: Loss of TEA and MPP(+) uptake activity.
- G216 (= G126) mutation to A: Decreased TEA and MPP(+) uptake.
- S217 (≠ A127) mutation to G: No change in TEA and MPP(+) uptake.
- W218 (≠ M128) mutation to F: Decreased guanidine, histamine, serotonin and TEA uptake. No change in MPP(+) uptake. No change in TEA and MPP(+) affinity. Decreased TEA Vmax. No change in MPP(+) Vmax.; mutation to L: Decreased guanidine, histamine, serotonin, TEA and MPP(+) uptake. Decreased TEA affinity. No change in MPP(+) affinity. Decreased TEA and MPP(+) Vmax.; mutation to Y: Decreased guanidine, histamine, serotonin and TEA uptake. No change in MPP(+) uptake. Increased TEA and MPP(+) affinity. Decreased TEA and MPP(+) Vmax.
- V219 (≠ P129) mutation to L: No change in TEA and MPP(+) uptake.
- S220 (≠ N130) mutation to I: Decreased TEA and MPP(+) uptake.
- G221 (≠ T131) mutation to A: Decreased TEA and MPP(+) uptake.
- Y222 (≠ I132) mutation to F: No change in guanidine, histamine, serotonin, TEA and MPP(+) uptake. Increased TEA affinity. No change in MPP(+) affinity. Decreased TEA Vmax. No change in MPP(+) Vmax.; mutation to L: Decreased guanidine, serotonin, TEA and MPP(+) uptake. No change in histamine uptake. Increased TEA and MPP(+) affinity. Decreased TEA and MPP(+) Vmax.
- T223 (= T133) mutation to I: Decreased TEA uptake. No change in MPP(+) uptake.
- L224 (≠ M134) mutation to V: Decreased TEA and MPP(+) uptake.
- I225 (≠ T135) mutation to G: No change in TEA and MPP(+) uptake.
- T226 (≠ S136) mutation to A: Decreased TEA uptake. No change in MPP(+) uptake.
- E227 (= E137) mutation to D: Loss of TEA and MPP(+) uptake activity.; mutation to Q: Loss of TEA and MPP(+) uptake activity.
- F228 (≠ Y138) mutation to I: No change in TEA and MPP(+) uptake.
- V229 (≠ L139) mutation to A: Decreased TEA and MPP(+) uptake.; mutation to L: Loss of TEA and MPP(+) uptake activity.
- S286 (= S200) mutation to A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-292; A-296; A-328 and A-550. No effect of PKA activation on ASP uptake. No effect of PKA activation on ASP uptake; when associated with A-292; A-296; A-328 and A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-292; A-296; A-328 and A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-292; A-296; A-328 and A-550. suppresses phosphorylation by PKC; when associated with A-292; A-296; A-328 and A-550.
- S292 (vs. gap) mutation to A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-296; A-328 and A-550. No effect of PKA activation on ASP uptake. No effect of PKA activation on ASP uptake; when associated with A-286; A-296; A-328 and A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-296; A-328 and A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-296; A-328 and A-550. suppresses phosphorylation by PKC; when associated with A-286; A-296; A-328 and A-550.
- T296 (≠ Q208) mutation to A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-292; A-328; A-550. Significant increase of the ASP uptake by PKA activation. No effect of PKA activation on ASP uptake; when associated with A-286; A-292; A-328; A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-292; A-328; A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-292; A-328 and A-550. suppresses phosphorylation by PKC; when associated with A-286; A-292; A-328 and A-550.
- C322 (≠ W232) mutation to S: Reduces the activation by MMTS. Abolishes the activation by MMTs; when associated with M-451. Choline affinity is increased fivefold by MMTS. Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; A-358; A-418; S-437; A-470 and A-474. Choline affinity is increased four- to fivefold; when associated with M-451.
- S328 (≠ A238) mutation to A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-292; A-296 and A-550. No effect of PKA activation on ASP uptake. No effect of PKA activation on ASP uptake; when associated with A-286; A-292; A-296 and A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-292; A-296; A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-292; A-296 and A-550. suppresses phosphorylation by PKC; when associated with A-286; A-292; A-296 and A-550.
- C358 (≠ L267) mutation to A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-418; S-437; A-470 and A-474.
- C418 (= C332) mutation to A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; S-437; A-470 and A-474.
- C437 (≠ I350) mutation to S: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; A-418; A-470 and A-474.
- C451 (≠ G363) mutation to M: Reduces the activation by MMTS. Abolishes the activation by MMTs; when associated with S-322. Abolishes the effect of MMTs on choline-induced currents. Choline affinity is not influenced by MMTS. Choline affinity is increased four- to fivefold; when associated with S-322.
- C470 (≠ S384) mutation to A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; A-418; A-437 and A-474.
- C474 (≠ G388) mutation to A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; A-418; A-437 and A-470.
- D475 (≠ R389) mutation to E: Decreased MPP(+) uptake, no change in MPP(+) affinity. Decreased NMN uptake, increased NMN affinity. Decreased choline uptake, increased choline affinity.; mutation to N: Decreased MPP(+) uptake.; mutation to R: Decreased MPP(+) uptake.
Sites not aligning to the query:
- 26 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-155; A-179; S-322; A-358; A-418; S-437; A-470 and A-474.
- 550 T→A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-292; A-296; A-328. Significant increase of the ASP uptake by PKA activation. No effect of PKA activation on ASP uptake; when associated with A-286; A-292; A-296 and A-328. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-292; A-296; A-328. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-292; A-296 and A-328. suppresses phosphorylation by PKC; when associated with A-286; A-292; A-296 and A-328.
O08966 Solute carrier family 22 member 1; Organic cation transporter 1; mOCT1 from Mus musculus (Mouse) (see paper)
26% identity, 77% coverage: 47:393/452 of query aligns to 134:479/556 of O08966
Sites not aligning to the query:
- 32 L→F: Increased trospium uptake. Increased trospium affinity. No change in fenoterol uptake.
- 36 Y→C: Decreased fenoterol uptake. Decreased fenoterol affinity. No change in trospium uptake. No change in terbutaline affinity.
8et8A Cryo-em structure of the organic cation transporter 1 in complex with verapamil (see paper)
27% identity, 72% coverage: 68:394/452 of query aligns to 156:478/532 of 8et8A
- binding (2S)-2-(3,4-dimethoxyphenyl)-5-{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino}-2-(propan-2-yl)pentanenitrile: K213 (≠ G125), W216 (≠ M128), Q240 (≠ F152), W353 (≠ F263), Y360 (≠ I270), F378 (≠ L288), S381 (≠ A291), E385 (≠ T295), C449 (≠ G363), S469 (≠ N385)
Sites not aligning to the query:
8et7A Cryo-em structure of the organic cation transporter 1 in complex with diphenhydramine (see paper)
27% identity, 72% coverage: 68:394/452 of query aligns to 156:478/532 of 8et7A
Sites not aligning to the query:
O15245 Solute carrier family 22 member 1; Organic cation transporter 1; hOCT1 from Homo sapiens (Human) (see 10 papers)
27% identity, 72% coverage: 69:394/452 of query aligns to 158:479/554 of O15245
- L160 (≠ T71) to F: no changes in both MPP(+) and TEA uptake; abolishes MPP(+) uptake when associated with S-401; largely localized to the plasma membrane; dbSNP:rs683369
- S189 (≠ F100) to L: no changes in MPP(+) uptake; dbSNP:rs34104736
- G220 (≠ T131) to V: affects transporter activity; reduction of MPP(+) uptake when associated with V-408; dbSNP:rs36103319
- Y240 (≠ M151) mutation to F: Decreased TEA uptake.
- P283 (= P198) to L: in dbSNP:rs4646277; mutation to A: Decreased TEA uptake.
- R287 (= R202) to G: in dbSNP:rs4646278
- P341 (≠ R251) to L: affects transporter activity; reduction of TEA uptake; reduction o MPP(+) uptake when associated with V-408; largely localized to the plasma membrane; dbSNP:rs2282143
- R342 (≠ Q252) to H: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs34205214
- Y361 (≠ I270) mutation to F: Decreased TEA uptake.
- Y376 (≠ G285) mutation to F: Decreased TEA uptake.
- G401 (≠ N317) to S: affects transporter activity; reduction of MPP(+), serotonin and TEA uptake; no MPP(+) uptake when associated with L-160; dbSNP:rs34130495
- M408 (≠ L324) to V: does not affect transporter activity; no changes in MPP(+) uptake when associated with F-14; no changes in MPP(+) uptake when associated with F-85; no changes in MPP(+) uptake when associated with L-189; no changes in MPP(+) uptake when associated with H-342; no changes in MPP(+) uptake when associated with M-420 del; no changes in MPP(+) uptake when associated with I-440; no changes in MPP(+) uptake when associated with I-461; no changes in MPP(+) uptake when associated with M-488; reduction of MPP uptake when associated with C-61; no MPP(+) uptake when associated with V-220; reduction of MPP(+) uptake when associated with L-341; no MPP(+) uptake when associated with S-401; no MPP(+) uptake when associated with R-465; dbSNP:rs628031
- M420 (= M335) natural variant: Missing (reduction of serum O-isobutanoyl-(R)-carnitine levels; no change in MPP(+) uptake; no changes in MPP(+) uptake when associated with V-408; dbSNP:rs72552763)
- M440 (≠ I355) to I: in dbSNP:rs35956182
- V461 (≠ S376) to I: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs34295611
- G465 (= G380) to R: reduction of the localization to the basolateral membrane; no MPP(+) uptake when associated with V-408; dbSNP:rs34059508; mutation to A: No changes in MPP(+) uptake.
Sites not aligning to the query:
- 14 S → F: exclusively found in the African American population; increased MPP(+) uptake when associated with V-408; dbSNP:rs34447885
- 24 I→L: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 28 L→I: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 31 A→S: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 32 F→L: No change in fenoterol uptake. Decreased trospium uptake. Decreased trospium affinity.
- 36 C→Y: Increased fenoterol uptake. Increased fenoterol affinity. No change in trospium uptake. No change in terbutaline uptake. No change in terbutaline affinity.
- 41 F → L: in dbSNP:rs2297373
- 61 R → C: affects transporter activity; reduction of MPP(+) uptake; reduction of serum O-isobutanoyl-(R)-carnitine levels; reduction of MPP(+) uptake when associated with V-408; dbSNP:rs12208357
- 85 L → F: no changes in MPP(+) uptake; when associated with V-408; dbSNP:rs35546288
- 88 C → R: affects transporter activity; reduction of MPP(+), serotonin and TEA uptake; dbSNP:rs55918055
- 488 R → M: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs35270274
Query Sequence
>BWI76_RS19590 FitnessBrowser__Koxy:BWI76_RS19590
MTQRLELQKLLNAAPVGARQWRVIICCFLVVMLDGFDTAAIGFIAPDIRSHWQLTAGDLA
PLFGAGLLGLTAGALLCGPLSDRFGRKRVIEFCVALFGLFSLLSAFAPDLQMLVFLRFLT
GLGLGGAMPNTITMTSEYLPARRRGALVTLMFCGFTLGSAFGGVVSAQLVPLIGWHGILV
LGGVLPLILAVALVPLLPESPRWQIRRQLPQATIARTVGAITGERYNDTHFWLDEPAAGA
KGSISQLFAGRQLAITLMLWVVFFMSLLIIYLLSSWMPTLLNHRGIDLQHASWVTAAFQI
GGTFGALLLGVLMDRFNPYRVLALSYGLGAVCIVMIGLSENGLWLMALAIFGTGIGISGS
QVGLNALTATLYPTQSRATGVSWSNAVGRCGAIVGSLSGGVMMAMNFSFDTLFFVIAVPA
VVSAVMLILLTLAVRNPTSVPAALPSAGIVNK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory