Comparing BWI76_RS20035 FitnessBrowser__Koxy:BWI76_RS20035 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
8hkbA Tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d (see paper)
23% identity, 68% coverage: 27:247/326 of query aligns to 2:215/302 of 8hkbA
Sites not aligning to the query:
7ndsA Crystal structure of tphc in a closed conformation (see paper)
22% identity, 78% coverage: 69:321/326 of query aligns to 42:290/294 of 7ndsA
Sites not aligning to the query:
7ndrD Crystal structure of tphc in an open conformation (see paper)
22% identity, 78% coverage: 69:321/326 of query aligns to 42:290/293 of 7ndrD
2dvzA Structure of a periplasmic transporter (see paper)
21% identity, 69% coverage: 27:251/326 of query aligns to 3:223/300 of 2dvzA
Sites not aligning to the query:
>BWI76_RS20035 FitnessBrowser__Koxy:BWI76_RS20035
MNIPFLRHLSALALCLCTASAWAVEAPSRTECIAPAKPGGGFDLTCKLIQVSLMETGAIK
KPMRVTYMPGGVGAVAYNAIVAQRPGEPGTVVAFSGGSLLNLAQGKFGRYGVDDVRWLAS
VGTDYGMIAVRTDSPWKNLPSFMAAMEKNPASIVIGAGASIGSQDWMKAALLAQKANVDP
HKMRYVAFEGGGEPVTALLGNHVQAVSGDLSEMVPYLQGNKIRVLAVFANERLPGALANV
PTAKEQGYDLVWPIIRGFFVGPKVSDADYQWWVDEFTKLQQTDAFKKQRELRGLFEFNMN
GKELDAYVKKQVEAYRQQAKSFGLAK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory