SitesBLAST
Comparing BWI76_RS21205 FitnessBrowser__Koxy:BWI76_RS21205 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
38% identity, 95% coverage: 5:459/478 of query aligns to 2:475/491 of P0AGF4
- F24 (= F27) mutation to A: Decreases xylose transport.
- G83 (= G79) mutation to A: Abolishes xylose transport.
- R133 (= R111) mutation R->C,H,L: Abolishes xylose transport.
- E153 (= E131) mutation to A: Abolishes xylose transport.
- R160 (= R138) mutation to A: Abolishes xylose transport.
- Q168 (= Q146) binding ; mutation to A: Abolishes xylose transport.
- Q288 (= Q278) mutation to A: Abolishes xylose transport.
- QQ 288:289 (= QQ 278:279) binding
- Q289 (= Q279) mutation to A: Strongly decreases xylose transport.
- N294 (= N284) binding ; mutation to A: Abolishes xylose transport.
- Y298 (≠ N288) mutation to A: Abolishes xylose transport.
- N325 (= N315) mutation to A: No effect on xylose transport.
- G340 (= G330) mutation to A: Abolishes xylose transport.
- R341 (= R331) mutation R->A,W: Abolishes xylose transport.
- W392 (= W382) binding ; mutation to A: Abolishes xylose transport.
- E397 (= E387) mutation to A: Abolishes xylose transport.
- R404 (= R394) mutation to A: Strongly decreases xylose transport.
- Q415 (≠ L405) binding
- W416 (= W406) mutation to A: Strongly decreases xylose transport.
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
38% identity, 94% coverage: 12:459/478 of query aligns to 5:471/475 of 4gc0A
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
38% identity, 94% coverage: 12:459/478 of query aligns to 5:471/475 of 4gbzA
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
38% identity, 94% coverage: 12:459/478 of query aligns to 5:471/475 of 4gbyA
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
31% identity, 91% coverage: 33:465/478 of query aligns to 25:440/446 of A0A0H2VG78
- R102 (= R111) mutation to A: Loss of transport activity.
- I105 (≠ G114) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (= E131) mutation to A: Loss of transport activity.
- Q137 (= Q146) mutation to A: Loss of transport activity.
- Q250 (= Q278) mutation to A: Loss of transport activity.
- Q251 (= Q279) mutation to A: Loss of transport activity.
- N256 (= N284) mutation to A: Loss of transport activity.
- W357 (= W382) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 22 D→N: Affects symport activity. May function as an uniporter.
Q8VZR6 Inositol transporter 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 97% coverage: 6:468/478 of query aligns to 24:485/509 of Q8VZR6
- ER 481:482 (≠ QR 464:465) mutation to AA: No effect on targeting.
Sites not aligning to the query:
- 479:509 mutation Missing: Leads to endoplasmic reticulum relocalization.
- 500:509 mutation Missing: Leads to endoplasmic reticulum relocalization.
- 502:504 mutation LLE->AAA,SSS: Leads to plasma membrane relocalization.
Q9LT15 Sugar transport protein 10; AtSTP10; D-glucose-H(+) symport protein STP10; D-glucose-proton symporter STP10; Hexose transporter 10 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
29% identity, 94% coverage: 12:458/478 of query aligns to 24:485/514 of Q9LT15
- F39 (= F27) mutation to A: Reduces affinity for glucose 8-fold.
- L43 (≠ W31) mutation to A: Reduces affinity for glucose 150-fold and turns STP10 into a low affinity transporter.
- C77 (= C64) modified: Disulfide link with 449; mutation to A: Increases sensitivity to alkaline pH and can only function fully at acidic pH (pH < 5).
- E162 (= E131) mutation to Q: Abolishes glucose transport activity; when associated with N-344.
- Q177 (= Q146) binding ; mutation to A: Reduces affinity for glucose 37-fold.
- I184 (≠ V153) mutation to A: Reduces affinity for glucose 3-fold.
- Q295 (= Q278) binding
- Q296 (= Q279) binding
- N301 (= N284) binding
- N332 (= N315) binding
- D344 (= D327) mutation to N: Abolishes glucose transport activity; when associated with Q-162.
- W410 (= W382) binding
- C449 (≠ A421) modified: Disulfide link with 77; mutation to A: Increases sensitivity to alkaline pH and can only function fully at acidic pH (pH < 5).
7aaqA Sugar/h+ symporter stp10 in outward occluded conformation (see paper)
29% identity, 94% coverage: 12:458/478 of query aligns to 4:465/487 of 7aaqA
P38695 Probable glucose transporter HXT5 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
29% identity, 95% coverage: 12:465/478 of query aligns to 85:552/592 of P38695
Sites not aligning to the query:
- 61 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
7aarA Sugar/h+ symporter stp10 in inward open conformation (see paper)
28% identity, 94% coverage: 12:458/478 of query aligns to 9:470/485 of 7aarA
- binding Octyl Glucose Neopentyl Glycol : L28 (≠ W31), I90 (vs. gap), H94 (≠ L78), V98 (≠ L82), F101 (≠ I85), N138 (≠ S122), P142 (= P126), N158 (≠ V142), F161 (≠ N145), Q162 (= Q146), I165 (= I149), D210 (≠ E209), G391 (vs. gap), P392 (= P379), W395 (= W382), M419 (≠ W406)
- binding beta-D-glucopyranose: Q280 (= Q278), N286 (= N284), M289 (≠ F287), G391 (vs. gap), W395 (= W382)
Q9C757 Probable inositol transporter 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 72% coverage: 9:353/478 of query aligns to 24:362/580 of Q9C757
Sites not aligning to the query:
- 399 C→A: Strongly decreased nickel inhibition; when associated with A-402, A-410 and A-413.; C→S: No effect on inostol transport or nickel inhibition. No effect on inostol transport or nickel inhibition; when associated with S-410.
- 402 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-410 and A-413.
- 410 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-413.; C→S: No effect on inostol transport or nickel inhibition; when associated with S-399.
- 413 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-410.
P32037 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Mus musculus (Mouse) (see paper)
28% identity, 96% coverage: 19:475/478 of query aligns to 16:479/493 of P32037
- N43 (≠ S46) modified: carbohydrate, N-linked (GlcNAc...) asparagine
P11169 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Homo sapiens (Human) (see paper)
28% identity, 96% coverage: 19:475/478 of query aligns to 16:478/496 of P11169
- Q159 (= Q146) binding
- QLS 277:279 (≠ AVF 275:277) Important for selectivity against fructose; mutation to HVA: Confers moderate fructose transport activity.
- QQ 280:281 (= QQ 278:279) binding
- N286 (= N284) binding
- N315 (= N315) binding
- E378 (≠ A374) binding
- W386 (= W382) binding
O23492 Inositol transporter 4; Myo-inositol-proton symporter INT4; Protein INOSITOL TRANSPORTER 4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
33% identity, 75% coverage: 5:361/478 of query aligns to 19:372/582 of O23492
Sites not aligning to the query:
- 559:561 LLE→AAA: No effect on targeting.
- 559:582 mutation Missing: No effect on targeting.
- 564:565 FK→AA: No effect on targeting.
- 570:575 RRREKK→AAAAAA: No effect on targeting.
P17809 Solute carrier family 2, facilitated glucose transporter member 1; Glucose transporter type 1, erythrocyte/brain; GLUT-1; GT1 from Mus musculus (Mouse) (see 3 papers)
28% identity, 93% coverage: 20:464/478 of query aligns to 19:469/492 of P17809
- N45 (≠ S46) modified: carbohydrate, N-linked (GlcNAc...) asparagine
Sites not aligning to the query:
- 485 P→L: Lethality immediately after birth in knockin mice; caused by creation of a dileucine internalization motif that promotes mislocalization of the protein.
4zw9A Crystal structure of human glut3 bound to d-glucose in the outward- occluded conformation at 1.5 angstrom (see paper)
29% identity, 94% coverage: 19:466/478 of query aligns to 16:470/470 of 4zw9A
- binding beta-D-glucopyranose: Q159 (= Q146), I166 (≠ V153), Q280 (= Q278), Q281 (= Q279), N286 (= N284), F377 (≠ Y373), W386 (= W382)
- binding alpha-D-glucopyranose: Q159 (= Q146), I162 (= I149), I166 (≠ V153), Q280 (= Q278), Q281 (= Q279), N286 (= N284), W386 (= W382)
7crzA Crystal structure of human glucose transporter glut3 bound with c3361 (see paper)
29% identity, 94% coverage: 19:466/478 of query aligns to 14:468/469 of 7crzA
- binding (2S,3R,4S,5R,6R)-6-(hydroxymethyl)-4-undec-10-enoxy-oxane-2,3,5-triol: T26 (≠ W31), A66 (= A60), S69 (vs. gap), Q157 (= Q146), I164 (≠ V153), Q278 (= Q278), Q279 (= Q279), N284 (= N284), N313 (= N315), F375 (≠ Y373), W384 (= W382), N411 (≠ C409), F412 (= F410), G415 (≠ T413)
7spsA Crystal structure of human glucose transporter glut3 bound with exofacial inhibitor sa47 (see paper)
29% identity, 94% coverage: 19:466/478 of query aligns to 13:467/468 of 7spsA
- binding methyl N-[(2-{4-[4-(5-fluoro-2-methoxyphenyl)piperazin-1-yl]-1H-pyrazolo[3,4-d]pyrimidin-1-yl}phenyl)methyl]-beta-alaninate: F21 (= F27), T25 (≠ W31), N29 (≠ G35), Q156 (= Q146), I163 (≠ V153), Q278 (= Q279), F286 (= F287), A308 (≠ T311), N312 (= N315), F374 (≠ Y373), E375 (≠ A374), N406 (≠ L405), W407 (= W406), N410 (≠ C409)
6m20B Crystal structure of plasmodium falciparum hexose transporter pfht1 bound with glucose (see paper)
28% identity, 84% coverage: 12:414/478 of query aligns to 8:423/478 of 6m20B
5c65A Structure of the human glucose transporter glut3 / slc2a3
28% identity, 92% coverage: 19:458/478 of query aligns to 12:449/457 of 5c65A
- binding Octyl Glucose Neopentyl Glycol : L42 (≠ I47), L58 (≠ G54), F75 (≠ L69), S76 (≠ I70), L79 (≠ W73), R87 (≠ K81), L95 (≠ V89), L96 (= L90), L121 (≠ I112), P199 (≠ F205)
- binding cholesterol hemisuccinate: I270 (≠ M272), S396 (≠ A404), T399 (≠ I407)
Query Sequence
>BWI76_RS21205 FitnessBrowser__Koxy:BWI76_RS21205
MNNAQTHLKMGYVWTICLVAACGGLLFGYDWVVIGGAKPFYEAWFSITDPAQSGWAMSSA
LVGCVFGALISGWCADKLGRKLPLILSAVLFSASAWGTAVASSFDMFVVYRIVGGVGIGL
ASALSPLYIAEVSPAEKRGRFVAVNQLTIVIGVLAAQLINLMIAEPVATGATQQMIVETW
NGQMGWRWMFGAELVPALAFLVLMFFVPESPRWLMKAGKPERARAALERIGSADYADRIL
RDIAHTLEKDNHKVSYGALLAPQVKPIVIIGMVLAVFQQWCGINVIFNYAQEIFASAGFD
INSTLKSIVATGVVNLVFTLAALPLVDKIGRRKLMLLGASGLTLIYVLIAGAYAMGIMGW
PVLLLVLAAIAIYALTLAPVTWVLLAEIFPNRVRGLAMSLGTLALWIACFLLTYTFPLLN
AGLGAAGSFLLYGVICAAGYLYILRNVPETKGVTLEALEEQLAQRHTGVNAAKQEQTR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory