Comparing BWI76_RS22075 FitnessBrowser__Koxy:BWI76_RS22075 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
P0AFM2 Glycine betaine/proline betaine-binding periplasmic protein; GBBP from Escherichia coli (strain K12) (see 2 papers)
86% identity, 100% coverage: 1:331/331 of query aligns to 1:330/330 of P0AFM2
1r9qA Structure analysis of prox in complex with proline betaine (see paper)
88% identity, 94% coverage: 22:331/331 of query aligns to 1:309/309 of 1r9qA
>BWI76_RS22075 FitnessBrowser__Koxy:BWI76_RS22075
MRHTAILATALTALISTTAFAADLPGKGITVKPIQSTISEETFQTLLVSRALEKLGYTVD
KPSEVDYNVGYTSLASGDATFTAVNWQPLHDDMYAAAGGDKKFYRQGVFVNGAAQGYLID
KKTAEQYHIKSIDQLKDPKIAKLFDTNGDGKADLTGCTPGWGCEAVINHQLDAYGLNNTV
THNQGNYAAMMADTIARYKEGKPVIYYTWTPYWVSDVLKPGKDVVWLQVPFSSLPGVQKN
IDTKLSNGANYGFPVSTMHIVANKAWAEKNPAAAKLFSIMKLPIADINAENAMMHEGHGS
EADIQGHVDGWIKAHQQQFDGWVNEALAAQK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory