SitesBLAST
Comparing BWI76_RS24860 FitnessBrowser__Koxy:BWI76_RS24860 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2jg1C Structure of staphylococcus aureus d-tagatose-6-phosphate kinase with cofactor and substrate (see paper)
30% identity, 100% coverage: 1:304/304 of query aligns to 6:315/315 of 2jg1C
- active site: G256 (≠ C247), S257 (≠ A248), G258 (= G249), D259 (= D250)
- binding phosphoaminophosphonic acid-adenylate ester: S227 (≠ T218), G229 (= G220), A230 (= A221), G232 (= G223), I246 (≠ A237), I249 (= I240), V251 (≠ L242), V255 (≠ A246), G256 (≠ C247), S257 (≠ A248), G258 (= G249), D259 (= D250), T261 (≠ A252), N283 (≠ S274), G286 (= G277), M287 (≠ A278)
- binding 6-O-phosphono-beta-D-tagatofuranose: D17 (= D12), G42 (= G37), K43 (= K38), R93 (= R88), C95 (≠ N90), L108 (≠ V103), G140 (= G134), S141 (= S135), D259 (= D250)
2jg1A Structure of staphylococcus aureus d-tagatose-6-phosphate kinase with cofactor and substrate (see paper)
30% identity, 100% coverage: 1:304/304 of query aligns to 9:318/318 of 2jg1A
- active site: G259 (≠ C247), S260 (≠ A248), G261 (= G249), D262 (= D250)
- binding phosphoaminophosphonic acid-adenylate ester: K46 (= K38), N193 (= N182), S230 (≠ T218), G232 (= G220), G235 (= G223), I252 (= I240), V254 (≠ L242), G259 (≠ C247), S260 (≠ A248), G261 (= G249), D262 (= D250), T264 (≠ A252), N286 (≠ S274), G289 (= G277), M290 (≠ A278)
2jgvB Structure of staphylococcus aureus d-tagatose-6-phosphate kinase in complex with adp (see paper)
30% identity, 100% coverage: 1:304/304 of query aligns to 5:314/314 of 2jgvB
- active site: G255 (≠ C247), S256 (≠ A248), G257 (= G249), D258 (= D250)
- binding adenosine-5'-diphosphate: S226 (≠ T218), A229 (= A221), I248 (= I240), P253 (≠ S245), S256 (≠ A248), G257 (= G249), N282 (≠ S274), G285 (= G277), M286 (≠ A278)
2f02A Crystal structure of lacc from enterococcus faecalis in complex with atp
28% identity, 100% coverage: 1:304/304 of query aligns to 2:312/319 of 2f02A
- binding adenosine-5'-triphosphate: N186 (= N182), S224 (≠ T218), G226 (= G220), I243 (≠ A237), I246 (= I240), G253 (≠ C247), S254 (≠ A248), G255 (= G249), T258 (≠ A252), M280 (≠ S274), G283 (= G277), M284 (≠ A278)
3uqeA Crystal structure of the phosphofructokinase-2 mutant y23d from escherichia coli
27% identity, 91% coverage: 2:278/304 of query aligns to 4:284/307 of 3uqeA
- active site: G253 (≠ C247), A254 (= A248), G255 (= G249), D256 (= D250)
- binding adenosine-5'-triphosphate: K185 (= K180), N187 (= N182), S224 (≠ T218), G226 (= G220), P227 (≠ A221), G229 (= G223), S248 (≠ L242), A254 (= A248), G255 (= G249), M258 (≠ A252), V280 (≠ S274), G283 (= G277), S284 (≠ A278)
- binding pyrophosphate 2-: N187 (= N182), K189 (≠ D184)
Sites not aligning to the query:
3uqdB Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with substrates and products (see paper)
27% identity, 91% coverage: 2:278/304 of query aligns to 4:284/309 of 3uqdB
- active site: G253 (≠ C247), A254 (= A248), G255 (= G249), D256 (= D250)
- binding adenosine-5'-diphosphate: K185 (= K180), N187 (= N182), S224 (≠ T218), G226 (= G220), P227 (≠ A221), G229 (= G223), S248 (≠ L242), M258 (≠ A252), V280 (≠ S274), G283 (= G277), S284 (≠ A278)
- binding adenosine-5'-triphosphate: Y23 (≠ K21), K27 (≠ V25)
- binding 6-O-phosphono-beta-D-fructofuranose: K27 (≠ V25), R29 (= R27)
- binding 1,6-di-O-phosphono-beta-D-fructofuranose: D14 (= D12), G39 (= G37), N43 (= N41), R90 (= R88), R105 (≠ K101), S139 (= S135), G253 (≠ C247)
3uqdA Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with substrates and products (see paper)
27% identity, 91% coverage: 2:278/304 of query aligns to 4:284/309 of 3uqdA
- active site: G253 (≠ C247), A254 (= A248), G255 (= G249), D256 (= D250)
- binding adenosine-5'-triphosphate: K185 (= K180), S224 (≠ T218), G226 (= G220), P227 (≠ A221), G229 (= G223), T251 (≠ S245), G255 (= G249), M258 (≠ A252), V280 (≠ S274), G283 (= G277), S284 (≠ A278)
- binding 6-O-phosphono-beta-D-fructofuranose: D14 (= D12), G38 (≠ N36), G39 (= G37), N43 (= N41), R90 (= R88), S139 (= S135), D256 (= D250)
- binding 1,6-di-O-phosphono-beta-D-fructofuranose: K27 (≠ V25), R29 (= R27)
Sites not aligning to the query:
3n1cA Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with fructose-6-phosphate (see paper)
27% identity, 91% coverage: 2:278/304 of query aligns to 4:284/309 of 3n1cA
- active site: G253 (≠ C247), A254 (= A248), G255 (= G249), D256 (= D250)
- binding 6-O-phosphono-beta-D-fructofuranose: D14 (= D12), K27 (≠ V25), R29 (= R27), G39 (= G37), N43 (= N41), R90 (= R88), G138 (= G134), S139 (= S135), D256 (= D250)
P06999 ATP-dependent 6-phosphofructokinase isozyme 2; ATP-PFK 2; Phosphofructokinase 2; 6-phosphofructokinase isozyme II; Phosphohexokinase 2; EC 2.7.1.11 from Escherichia coli (strain K12) (see 3 papers)
27% identity, 91% coverage: 2:278/304 of query aligns to 4:284/309 of P06999
- K27 (≠ V25) binding ; binding
- KPN 185:187 (= KPN 180:182) binding in other chain
- NQK 187:189 (≠ NDD 182:184) binding in other chain
- E190 (= E185) mutation to Q: Causes a 50-fold decrease in the kcat value and a 15-fold increment in the apparent KM for ATP.
- SLGPQG 224:229 (≠ TMGAEG 218:223) binding in other chain
- S248 (≠ L242) binding in other chain
- S250 (= S244) binding
- V252 (≠ A246) binding
- V280 (≠ S274) binding in other chain
- S284 (≠ A278) binding in other chain
Sites not aligning to the query:
- 286 binding
- 289 binding
- 291 binding
- 293 binding
3cqdA Structure of the tetrameric inhibited form of phosphofructokinase-2 from escherichia coli (see paper)
27% identity, 91% coverage: 2:278/304 of query aligns to 4:284/304 of 3cqdA
- active site: G253 (≠ C247), A254 (= A248), G255 (= G249), D256 (= D250)
- binding adenosine-5'-triphosphate: Y23 (≠ K21), G26 (≠ A24), K27 (≠ V25), K185 (= K180), N187 (= N182), N187 (= N182), K189 (≠ D184), S224 (≠ T218), G226 (= G220), P227 (≠ A221), G229 (= G223), S248 (≠ L242), T251 (≠ S245), A254 (= A248), G255 (= G249), M258 (≠ A252), V280 (≠ S274), G283 (= G277), S284 (≠ A278)
Sites not aligning to the query:
P9WID3 ATP-dependent 6-phosphofructokinase isozyme 2; ATP-PFK 2; Phosphofructokinase 2; Phosphofructokinase B; Phosphohexokinase 2; Tagatose-6-phosphate kinase; EC 2.7.1.11; EC 2.7.1.144 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
26% identity, 96% coverage: 2:293/304 of query aligns to 14:308/339 of P9WID3
- K283 (≠ H268) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
2ajrA Crystal structure of possible 1-phosphofructokinase (ec 2.7.1.56) (tm0828) from thermotoga maritima at 2.46 a resolution
26% identity, 100% coverage: 1:303/304 of query aligns to 2:308/320 of 2ajrA
3ie7A The crystal structure of phosphofructokinase (lin2199) from listeria innocua in complex with atp at 1.6a
24% identity, 100% coverage: 1:304/304 of query aligns to 2:308/309 of 3ie7A
- binding adenosine-5'-triphosphate: N188 (= N182), S220 (≠ T218), G222 (= G220), A223 (= A221), G225 (= G223), V242 (≠ I240), G249 (≠ C247), A250 (= A248), G251 (= G249), D252 (= D250), S279 (≠ G277), V283 (vs. gap)
3julA Crystal structure of listeria innocua d-tagatose-6-phosphate kinase bound with substrate
24% identity, 100% coverage: 1:304/304 of query aligns to 2:297/298 of 3julA
1gqtB Activation of ribokinase by monovalent cations (see paper)
26% identity, 77% coverage: 30:264/304 of query aligns to 34:268/307 of 1gqtB
- active site: A251 (≠ C247), A252 (= A248), G253 (= G249), D254 (= D250)
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N182), T222 (= T218), G224 (= G220), S225 (≠ A221), A252 (= A248), G253 (= G249)
- binding cesium ion: D248 (≠ S244), I250 (≠ A246)
- binding alpha-D-ribofuranose: G41 (= G37), N45 (= N41), E142 (≠ P137), D254 (= D250)
Sites not aligning to the query:
P0A9J6 Ribokinase; RK; EC 2.7.1.15 from Escherichia coli (strain K12) (see 3 papers)
26% identity, 77% coverage: 30:264/304 of query aligns to 35:269/309 of P0A9J6
Sites not aligning to the query:
- 14:16 binding
- 279 binding
1rk2A E. Coli ribokinase complexed with ribose and adp, solved in space group p212121 (see paper)
26% identity, 77% coverage: 30:264/304 of query aligns to 32:266/305 of 1rk2A
- active site: A249 (≠ C247), A250 (= A248), G251 (= G249), D252 (= D250)
- binding adenosine-5'-diphosphate: T220 (= T218), G222 (= G220), S223 (≠ A221), A250 (= A248), G251 (= G249)
- binding tetrafluoroaluminate ion: G213 (= G211), R215 (= R213)
- binding magnesium ion: D246 (≠ S244)
- binding alpha-D-ribofuranose: G38 (≠ N36), G39 (= G37), K40 (= K38), N43 (= N41), E140 (≠ S135), D252 (= D250)
Sites not aligning to the query:
6ilsB Structure of arabidopsis thaliana ribokinase complexed with ribose and atp (see paper)
23% identity, 80% coverage: 37:278/304 of query aligns to 40:287/313 of 6ilsB
- binding adenosine-5'-triphosphate: N189 (= N182), K225 (≠ T218), G227 (= G220), I246 (≠ A237), A248 (≠ K239), A257 (= A248), G258 (= G249), F261 (≠ A252), A286 (≠ G277), S287 (≠ A278)
- binding alpha-D-ribofuranose: G40 (= G37), K41 (= K38), N44 (= N41), E144 (≠ S135), D259 (= D250)
Sites not aligning to the query:
A1A6H3 Ribokinase; AtRBSK; RK; EC 2.7.1.15 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
23% identity, 80% coverage: 37:278/304 of query aligns to 106:353/379 of A1A6H3
Sites not aligning to the query:
- 1:74 mutation Missing: Loss of ribokinase activity.
7w93A Crystal structure of e.Coli pseudouridine kinase psuk complexed with n1-methyl-pseudouridine (see paper)
33% identity, 31% coverage: 179:273/304 of query aligns to 183:278/307 of 7w93A
Sites not aligning to the query:
- binding 5-[(2S,3R,4S,5R)-5-(hydroxymethyl)-3,4-bis(oxidanyl)oxolan-2-yl]-1-methyl-pyrimidine-2,4-dione: 13, 15, 39, 40, 41, 44, 96, 113, 142, 169
Query Sequence
>BWI76_RS24860 FitnessBrowser__Koxy:BWI76_RS24860
MIHTLTLNTAIDMNIFCDPLKPSAVNRTRHTEYCPNGKGVNVSLILNHYQQPTHIIGIFG
GFTGRYIVEELRQKKIKVTPAWVSEPTRINIFINDGAEEYKLVNPGAKIDDECKQQVIHH
LQCVASGDYLAISGSLPPGIESRFYAEIIELCQQKRCEVILDISHPVLRQLLELRPLLIK
PNDDELREIFGLDVSNHQQVREAMRTLHQLGARNVLLTMGAEGLYFSDGEGVWFCSAPKI
ALVSSACAGDAALGAFLSKWLNKEDVAHALALASATGADVAGSAGLGKLQRTEELLQQIQ
VVQL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory