Comparing BWI76_RS25275 FitnessBrowser__Koxy:BWI76_RS25275 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
O31645 PTS system mannose-specific EIIBCA component; EIIBCA-Man; EII-Man; EC 2.7.1.191 from Bacillus subtilis (strain 168) (see 2 papers)
28% identity, 91% coverage: 9:155/162 of query aligns to 501:648/650 of O31645
Sites not aligning to the query:
1j6tA Complex of enzyme iiamtl and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure (see paper)
26% identity, 78% coverage: 27:153/162 of query aligns to 17:141/144 of 1j6tA
C0H3V2 Mannitol-specific phosphotransferase enzyme IIA component; EIIA; EIII; PTS system mannitol-specific EIIA component from Bacillus subtilis (strain 168) (see paper)
27% identity, 88% coverage: 13:155/162 of query aligns to 3:141/143 of C0H3V2
P00550 PTS system mannitol-specific EIICBA component; EIICBA-Mtl; EII-Mtl; EC 2.7.1.197 from Escherichia coli (strain K12) (see 2 papers)
27% identity, 63% coverage: 52:153/162 of query aligns to 533:633/637 of P00550
Sites not aligning to the query:
>BWI76_RS25275 FitnessBrowser__Koxy:BWI76_RS25275
MINNDSALQLSNVLNQECTRSQVHCQSKKRALEIISELAAKQLGLSSQIVFEAILTREKM
GSTGIGNGIAIPHGKLEEDTLRAVGVFVQLETPIAFDAIDNQPVDLLFALLVPADQTKTH
LHTLSLVAKRLADKTICRRLRAAQSDEELYEIITEAGSNNEA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory