Comparing BWI76_RS26270 FitnessBrowser__Koxy:BWI76_RS26270 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2vi7C Structure of a putative acetyltransferase (pa1377)from pseudomonas aeruginosa (see paper)
43% identity, 96% coverage: 7:162/163 of query aligns to 8:164/165 of 2vi7C
2i79A The crystal structure of the acetyltransferase of gnat family from streptococcus pneumoniae
27% identity, 98% coverage: 3:161/163 of query aligns to 4:170/171 of 2i79A
2ge3A Crystal structure of probable acetyltransferase from agrobacterium tumefaciens
33% identity, 67% coverage: 54:163/163 of query aligns to 56:164/164 of 2ge3A
Sites not aligning to the query:
3ld2B The crystal structure of smu.2055 from streptococcus mutans ua159
28% identity, 83% coverage: 20:154/163 of query aligns to 2:150/162 of 3ld2B
4jwpA Crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis in complex with acetyl coa
27% identity, 97% coverage: 4:161/163 of query aligns to 4:164/165 of 4jwpA
4pv6G Crystal structure analysis of ard1 from thermoplasma volcanium (see paper)
29% identity, 96% coverage: 6:161/163 of query aligns to 8:148/154 of 4pv6G
4pv6A Crystal structure analysis of ard1 from thermoplasma volcanium (see paper)
29% identity, 96% coverage: 6:161/163 of query aligns to 8:148/154 of 4pv6A
6e1xA Crystal structure of product-bound complex of spermidine/spermine n- acetyltransferase speg
23% identity, 99% coverage: 2:163/163 of query aligns to 2:165/170 of 6e1xA
4r87A Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with coa and spermine (see paper)
23% identity, 99% coverage: 2:163/163 of query aligns to 2:165/170 of 4r87A
4r57A Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with acetyl-coa (see paper)
23% identity, 99% coverage: 2:163/163 of query aligns to 2:165/170 of 4r57A
4nczA Spermidine n-acetyltransferase from vibrio cholerae in complex with 2- [n-cyclohexylamino]ethane sulfonate. (see paper)
23% identity, 99% coverage: 2:163/163 of query aligns to 2:165/170 of 4nczA
4mi4A Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with spermine (see paper)
23% identity, 99% coverage: 2:163/163 of query aligns to 2:165/170 of 4mi4A
4mhdA Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with spermidine (see paper)
23% identity, 99% coverage: 2:163/163 of query aligns to 2:165/170 of 4mhdA
6cx8A Crystal structure of spermidine/spermine n-acetyltransferase speg from vibrio cholerae in complex with manganese ions.
23% identity, 99% coverage: 2:163/163 of query aligns to 3:166/173 of 6cx8A
Q9KL03 Spermidine N(1)-acetyltransferase; SAT; Spermidine/spermine N(1)-acetyltransferase; SSAT; EC 2.3.1.57 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) (see 2 papers)
23% identity, 99% coverage: 2:163/163 of query aligns to 3:166/173 of Q9KL03
6e1xC Crystal structure of product-bound complex of spermidine/spermine n- acetyltransferase speg
25% identity, 99% coverage: 2:163/163 of query aligns to 6:169/176 of 6e1xC
5cnpB X-ray crystal structure of spermidine n1-acetyltransferase from vibrio cholerae. (see paper)
23% identity, 99% coverage: 2:163/163 of query aligns to 2:165/171 of 5cnpB
4jxrB Crystal structure of a gnat superfamily phosphinothricin acetyltransferase (pat) from sinorhizobium meliloti in complex with accoa
30% identity, 47% coverage: 84:160/163 of query aligns to 88:163/185 of 4jxrB
Sites not aligning to the query:
6wfgA Crystal structure of human naa50 in complex with an inhibitor (compound 3) identified using DNA encoded library technology (see paper)
31% identity, 58% coverage: 55:148/163 of query aligns to 44:137/150 of 6wfgA
Sites not aligning to the query:
3tfyA Naa50p amino-terminal acetyltransferase bound to substrate peptide fragment and coa (see paper)
31% identity, 58% coverage: 55:148/163 of query aligns to 48:141/155 of 3tfyA
Sites not aligning to the query:
>BWI76_RS26270 FitnessBrowser__Koxy:BWI76_RS26270
MSDIVIRHAEPRDAEPLRQMTALPEVYHDTLQLPHPSMEMWQERLQPKPGSRHLVATIDE
QVVGHLKLSVEPNPRRSHVATFGVSVAAQAHGRGVGSALMREMINLCDNWLRVDRIELTV
FTDNPSAVALYRKFGFIVEGTGKKYALRNGEYVDAYFMARLKG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory