SitesBLAST
Comparing BWI76_RS26320 FitnessBrowser__Koxy:BWI76_RS26320 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
P53322 High-affinity nicotinic acid transporter; Nicotinic acid permease from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
27% identity, 61% coverage: 9:274/436 of query aligns to 78:347/534 of P53322
- K283 (≠ D215) modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Q9NRA2 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Membrane glycoprotein HP59; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Homo sapiens (Human) (see 8 papers)
25% identity, 66% coverage: 64:351/436 of query aligns to 113:407/495 of Q9NRA2
- K136 (≠ Q87) to E: in SD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transporter activity, but retains appreciable H(+)-coupled sialic acid transporter activity; dbSNP:rs80338795
- H183 (≠ L132) to R: in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity; dbSNP:rs119491109
- LL 198:199 (≠ VV 147:148) mutation to AA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- IL 266:267 (≠ LI 221:222) mutation to LA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- SSLRN 268:272 (≠ AQLQQ 223:227) natural variant: Missing (in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity)
- G328 (≠ S284) to E: in ISSD; some patients may manifest a milder phenotype consistent with Salla disease; markedly decreases H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs386833996
- P334 (= P290) to R: in ISSD; does not affect intracellular localization, targeted to lysosomes; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs119491110
- G371 (≠ C319) to V: in ISSD; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs777862172
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane.; LL→GG: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R → C: in SD; frequent variant in Finland; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transport activity, but retains appreciable H(+)-coupled sialic acid and nitrate transporter activity; dbSNP:rs80338794
Q8BN82 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Mus musculus (Mouse) (see paper)
24% identity, 53% coverage: 64:293/436 of query aligns to 113:341/495 of Q8BN82
- H183 (≠ L132) mutation to R: Abolishes sialic acid transporter activity. Does not affect L-aspartate and L-glutamate transporter activity.
Sites not aligning to the query:
- 39 R→C: Completely abolishes L-aspartate and L-glutamate transporter activity. Retains appreciable H(+)-coupled sialic acid transporter activity.
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
23% identity, 64% coverage: 26:306/436 of query aligns to 20:301/430 of P0AA76
- Y29 (≠ F35) binding
- D31 (= D37) mutation to N: Loss of galactonate transport activity.
- R32 (= R38) binding
- Y64 (= Y70) binding
- E118 (= E124) mutation to Q: Loss of galactonate transport activity.
Sites not aligning to the query:
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
25% identity, 44% coverage: 26:217/436 of query aligns to 9:193/409 of 6e9nA
Sites not aligning to the query:
Q9C0U9 Uncharacterized transporter PB1C11.03 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
24% identity, 49% coverage: 19:230/436 of query aligns to 95:308/570 of Q9C0U9
Sites not aligning to the query:
- 14 modified: Phosphoserine
6e9oA E. Coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form (see paper)
24% identity, 44% coverage: 26:217/436 of query aligns to 12:196/393 of 6e9oA
Sites not aligning to the query:
Q5Q0U0 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 (Anion/sugar transporter), member 5; Vesicular excitatory amino acid transporter; VEAT from Rattus norvegicus (Rat) (see 2 papers)
23% identity, 65% coverage: 64:345/436 of query aligns to 113:399/495 of Q5Q0U0
- K136 (≠ Q87) mutation to E: Markedly decreases H(+)-coupled sialic acid transporter activity.
- R168 (= R117) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- E171 (≠ L120) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-175.
- G172 (= G121) mutation to C: Decreases protein levels and alters subcellular localization.
- E175 (= E124) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-171.
- G176 (≠ A125) mutation to C: Decreases protein levels and alters subcellular localization.
- F179 (≠ Y128) mutation to C: Decreases the affinity and transport rate for D-glucuronate. Does not affect H(+)-coupled sialic acid transporter activity.
- P180 (= P129) mutation to C: Decreases protein levels and alters subcellular localization.
- H183 (≠ L132) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
- W186 (≠ A135) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- SSLKN 268:272 (≠ AQLQQ 223:227) mutation Missing: Abolishes H(+)-coupled sialic acid transporter activity.
- P334 (= P290) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
- G371 (≠ C319) mutation to V: Remains in the endoplasmic reticulum.
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R→C: Markedly decreases H(+)-coupled sialic acid transporter activity.
Q03567 Uncharacterized transporter slc-17.2 from Caenorhabditis elegans (see paper)
24% identity, 60% coverage: 66:325/436 of query aligns to 90:351/493 of Q03567
Sites not aligning to the query:
- 69 modified: carbohydrate, N-linked (GlcNAc...) asparagine
6zguA Crystal structure of a mfs transporter with bound 3-(2-methylphenyl) propanoic acid at 2.41 angstroem resolution
23% identity, 43% coverage: 46:233/436 of query aligns to 30:213/404 of 6zguA
Sites not aligning to the query:
6zgtA Crystal structure of a mfs transporter with bound 2-naphthoic acid at 2.39 angstroem resolution
23% identity, 43% coverage: 46:233/436 of query aligns to 30:213/404 of 6zgtA
Sites not aligning to the query:
6zgsA Crystal structure of a mfs transporter with bound 3-phenylpropanoic acid at 2.39 angstroem resolution
23% identity, 43% coverage: 46:233/436 of query aligns to 30:213/404 of 6zgsA
Sites not aligning to the query:
A0LNN5 L-lactate transporter; SfMCT from Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) (see paper)
26% identity, 37% coverage: 46:208/436 of query aligns to 36:194/412 of A0LNN5
- Y119 (= Y128) binding ; mutation Y->A,F: Loss of transport activity.
- L145 (≠ V155) mutation to A: Strong decrease in transport activity.
Sites not aligning to the query:
- 28 L→A: Loss of transport activity.
- 250 H→A: Strong decrease in transport activity.; H→F: Loss of transport activity.
- 256 R→A: No change in transport activity.; R→D: Increases transport activity.
- 257 D→A: Loss of transport activity.
- 276 N→A: Loss of transport activity.
- 280 binding ; R→A: Abolishes L-lactate binding and L-lactate transport.
- 331 Y→A: Loss of transport activity.; Y→F: No change in transport activity.
- 335 F→A: Increases transport activity.
- 359 F→A: Loss of transport activity.
- 362 C→A: Decrease in transport activity.
- 377 mutation K->A,D: No change in transport activity.
- 378 D→A: Loss of transport activity.
- 383 Y→A: Loss of transport activity.; Y→F: Strong decrease in transport activity.
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
27% identity, 22% coverage: 82:177/436 of query aligns to 82:177/452 of Q5EXK5
- D82 (≠ N82) mutation to A: Loss of activity.
Sites not aligning to the query:
- 311 V→W: Loss of activity.
- 314 D→A: Loss of activity.
Query Sequence
>BWI76_RS26320 FitnessBrowser__Koxy:BWI76_RS26320
MKTITAYDNPALNSAITKSWKRLVPLMFILYFIAFIDRVNVGFAKEAMQVDIGLSNSAFA
LGAGIFFAAYALFGIPANLILNKIGAQKWLSITTVLWGVLSALTGLVQTETQFIVLRFLL
GLGEAGFYPGILLLASIYFPNKVRASVVGIFVLGVPLALTLGSPISGALLEMHGFLGRPG
WFWMFFIEGIPAVIMGIFAWFWLDDTPAKARFLNDEEKKALIAQLQQEQRQTETSNVGTA
LKSLKVWHLALIYGTIQISVYGLMFFLPSQVASLMGSTLGFKESLVAAIPWACSAVGVYY
IPRLADKMPARRVLISVICMLAAALGLFVSAWSGPVLAIAALSLSAIGFLSVQPIFWTFP
AQIVSGSALAASIGFCTTMGAFCSFLAPLIRVEVDAFFGNDSAGLVALSLITVCCALLIA
ALAGRKATNGVAVPHH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory