SitesBLAST
Comparing BWI76_RS27260 FitnessBrowser__Koxy:BWI76_RS27260 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P67910 ADP-L-glycero-D-manno-heptose-6-epimerase; ADP-L-glycero-beta-D-manno-heptose-6-epimerase; ADP-glyceromanno-heptose 6-epimerase; ADP-hep 6-epimerase; AGME; EC 5.1.3.20 from Escherichia coli (strain K12) (see 3 papers)
96% identity, 100% coverage: 1:310/310 of query aligns to 1:310/310 of P67910
- FI 10:11 (= FI 10:11) binding
- DN 31:32 (= DN 31:32) binding
- K38 (= K38) binding
- K53 (= K53) binding
- EGACS 75:79 (= EGACS 75:79) binding
- N92 (= N92) binding
- Y140 (= Y140) active site, Proton acceptor; mutation to F: Severely compromises epimerase activity.
- K144 (= K144) binding
- N169 (= N169) binding
- V170 (= V170) binding
- K178 (= K178) active site, Proton acceptor; binding ; mutation to M: Severely compromises epimerase activity.
- S180 (= S180) binding
- H187 (= H187) binding
- FEGS 201:204 (= FEGS 201:204) binding
- K208 (= K208) mutation to M: Activity similar to that of the wild-type.
- R209 (= R209) binding
- D210 (= D210) mutation to N: Activity similar to that of the wild-type.
- K267 (= K267) modified: N6-acetyllysine
- Y272 (= Y272) binding
2x6tG Agme bound to adp-b-mannose (see paper)
96% identity, 99% coverage: 1:308/310 of query aligns to 1:308/308 of 2x6tG
- active site: S80 (= S80), S116 (= S116), F140 (≠ Y140), K144 (= K144), K178 (= K178), H187 (= H187), Q277 (= Q277), N282 (= N282), L283 (= L283)
- binding adenosine-5'-diphosphate: T81 (= T81), S180 (= S180), M181 (= M181), A182 (= A182), V184 (= V184), H187 (= H187), F201 (= F201), R209 (= R209), F243 (= F243), Y272 (= Y272)
- binding beta-D-mannopyranose: S79 (= S79), S116 (= S116), F140 (≠ Y140), K178 (= K178), M181 (= M181)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G6 (= G6), G9 (= G9), F10 (= F10), I11 (= I11), D31 (= D31), N32 (= N32), K38 (= K38), K53 (= K53), E75 (= E75), G76 (= G76), A77 (= A77), S79 (= S79), N92 (= N92), Y96 (= Y96), A114 (= A114), S116 (= S116), F140 (≠ Y140), K144 (= K144), Y167 (= Y167), V170 (= V170), H177 (= H177), K178 (= K178)
1eq2B The crystal structure of adp-l-glycero-d-mannoheptose 6-epimerase (see paper)
94% identity, 99% coverage: 1:307/310 of query aligns to 1:300/300 of 1eq2B
- active site: S116 (= S116), Y140 (= Y140), K144 (= K144), K178 (= K178)
- binding adenosine-5'-diphosphate-glucose: F168 (= F168), N169 (= N169), S180 (= S180), H187 (= H187), L200 (= L200), F201 (= F201), R209 (= R209), F243 (= F243), Y265 (= Y272), Q266 (= Q273)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G6 (= G6), F10 (= F10), I11 (= I11), D31 (= D31), N32 (= N32), K38 (= K38), K53 (= K53), E75 (= E75), G76 (= G76), A77 (= A77), S79 (= S79), N92 (= N92), Y96 (= Y96), A114 (= A114), S116 (= S116), Y140 (= Y140), K144 (= K144), Y167 (= Y167), F168 (= F168), V170 (= V170), H177 (= H177), K178 (= K178)
1eq2A The crystal structure of adp-l-glycero-d-mannoheptose 6-epimerase (see paper)
86% identity, 99% coverage: 1:307/310 of query aligns to 1:273/273 of 1eq2A
- active site: S116 (= S116), Y140 (= Y140), K144 (= K144), K178 (= K178)
- binding adenosine-5'-diphosphate-glucose: S180 (= S180), H187 (= H187), F230 (= F243)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G6 (= G6), F10 (= F10), I11 (= I11), D31 (= D31), N32 (= N32), K38 (= K38), K53 (= K53), E75 (= E75), G76 (= G76), A77 (= A77), S79 (= S79), N92 (= N92), Y96 (= Y96), A114 (= A114), S116 (= S116), Y140 (= Y140), K144 (= K144), Y167 (= Y167), F168 (= F168), V170 (= V170), H177 (= H177), K178 (= K178)
4ej0A Crystal structure of adp-l-glycero-d-manno-heptose-6-epimerase from burkholderia thailandensis (see paper)
57% identity, 98% coverage: 2:306/310 of query aligns to 3:326/330 of 4ej0A
- active site: A114 (= A114), S116 (= S116), Y139 (= Y140), S142 (= S143), K177 (= K178)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G7 (= G6), G10 (= G9), F11 (= F10), I12 (= I11), D32 (= D31), N33 (= N32), K39 (= K38), K54 (= K53), E75 (= E75), G76 (= G76), A77 (= A77), S79 (= S79), N92 (= N92), Y96 (= Y96), A114 (= A114), S116 (= S116), Y139 (= Y140), K143 (= K144), Y166 (= Y167), F167 (= F168), V169 (= V170), H176 (= H177), K177 (= K178)
3sxpD Crystal structure of helicobacter pylori adp-l-glycero-d-manno- heptose-6-epimerase (rfad, hp0859) (see paper)
30% identity, 99% coverage: 2:307/310 of query aligns to 13:312/314 of 3sxpD
- active site: S131 (= S116), A132 (= A117), G133 (≠ A118), Y154 (= Y140), F156 (≠ Y142), K158 (= K144), K190 (= K178)
- binding nicotinamide-adenine-dinucleotide: G17 (= G6), G20 (= G9), F21 (= F10), V22 (≠ I11), D43 (= D31), K44 (≠ N32), S51 (vs. gap), G53 (vs. gap), D69 (= D49), I70 (≠ Y50), Q90 (≠ E75), A91 (≠ G76), A92 (= A77), A129 (= A114), S131 (= S116), Y154 (= Y140), K158 (= K144), Y179 (= Y167), N181 (= N169), V182 (= V170), K190 (= K178)
6dntA Udp-n-acetylglucosamine 4-epimerase from methanobrevibacter ruminantium m1 in complex with udp-n-acetylmuramic acid (see paper)
27% identity, 98% coverage: 2:305/310 of query aligns to 6:305/310 of 6dntA
- active site: S120 (= S116), S121 (≠ A117), A122 (= A118), Y144 (= Y140), K148 (= K144), A187 (≠ S183)
- binding (2R)-2-{[(2R,3R,4R,5S,6R)-3-(acetylamino)-2-{[(S)-{[(R)-{[(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methoxy}(hydroxy)phosphoryl]oxy}(hydroxy)phosphoryl]oxy}-5-hydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-4-yl]oxy}propanoic acid: A80 (≠ S79), S120 (= S116), S121 (≠ A117), Y144 (= Y140), F172 (= F168), N173 (= N169), A187 (≠ S183), V188 (= V184), K191 (≠ H187), V203 (≠ K199), I204 (≠ L200), Y205 (≠ F201), Q210 (≠ F207), R212 (= R209), I246 (vs. gap), R269 (≠ L268), D272 (≠ R271)
- binding nicotinamide-adenine-dinucleotide: G10 (= G6), G13 (= G9), F14 (= F10), I15 (= I11), D33 (= D31), N34 (= N32), L35 (= L33), S36 (≠ K34), S37 (≠ D35), G38 (= G36), D57 (≠ F56), L58 (= L57), L76 (≠ E75), A77 (≠ G76), A78 (= A77), A80 (≠ S79), S118 (≠ A114), S119 (= S115), Y144 (= Y140), K148 (= K144), Y171 (= Y167), V174 (= V170)
- binding zinc ion: E209 (≠ G206), H275 (≠ F275)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
31% identity, 78% coverage: 2:242/310 of query aligns to 3:243/309 of 4zrnA
- active site: T117 (≠ S116), G119 (vs. gap), A120 (= A118), Y143 (= Y140), K147 (= K144), Y181 (≠ K178), G185 (≠ A182)
- binding nicotinamide-adenine-dinucleotide: G7 (= G6), G10 (= G9), F11 (= F10), I12 (= I11), D31 (= D31), N32 (= N32), S34 (≠ K34), S35 (≠ D35), G36 (= G36), S51 (≠ Y50), I52 (≠ M51), L73 (≠ E75), A74 (≠ G76), A75 (= A77), T92 (≠ Y88), S115 (≠ A114), S116 (= S115), Y143 (= Y140), K147 (= K144), Y170 (= Y167), V173 (= V170)
- binding uridine-5'-diphosphate-glucose: T117 (≠ S116), G119 (vs. gap), A120 (= A118), Y143 (= Y140), N172 (= N169), G185 (≠ A182), V186 (≠ S183), H201 (≠ K199), F203 (= F201), Y208 (≠ F207), R210 (= R209)
Sites not aligning to the query:
2c20A Crystal structure of udp-glucose 4-epimerase
29% identity, 80% coverage: 2:250/310 of query aligns to 3:266/329 of 2c20A
- active site: T117 (≠ S116), A118 (= A117), A119 (= A118), Y141 (= Y140), K145 (= K144), H184 (= H177)
- binding nicotinamide-adenine-dinucleotide: G7 (= G6), G10 (= G9), Y11 (≠ F10), I12 (= I11), D31 (= D31), N32 (= N32), Q34 (≠ K34), T35 (vs. gap), G36 (vs. gap), D51 (= D49), L52 (≠ Y50), F73 (≠ E75), A74 (≠ G76), A75 (= A77), N92 (= N93), Y141 (= Y140), K145 (= K144), Y168 (= Y167), F169 (= F168), V171 (= V170), H184 (= H177)
- binding zinc ion: E182 (= E175), H184 (= H177), E187 (≠ S180), H189 (≠ A182)
7k3pA The structure of the udp-glc/glcnac 4-epimerase from the human pathogen campylobacter jejuni
29% identity, 80% coverage: 2:249/310 of query aligns to 4:271/329 of 7k3pA
- binding nicotinamide-adenine-dinucleotide: G8 (= G6), G11 (= G9), Y12 (≠ F10), I13 (= I11), D32 (= D31), N33 (= N32), S35 (≠ K34), G37 (= G36), D57 (= D52), L58 (≠ K53), F79 (≠ E75), A80 (≠ G76), I83 (≠ S79), N98 (= N92), Y147 (= Y140), K151 (= K144), Y175 (= Y167), N177 (= N169), V178 (= V170)
4twrA Structure of udp-glucose 4-epimerase from brucella abortus
29% identity, 79% coverage: 2:246/310 of query aligns to 4:262/325 of 4twrA
- active site: S117 (= S116), C118 (≠ A117), A119 (= A118), Y141 (= Y140), K145 (= K144), H184 (≠ A182), H189 (= H187)
- binding nicotinamide-adenine-dinucleotide: G8 (= G6), G11 (= G9), F12 (= F10), I13 (= I11), D32 (= D31), N33 (= N32), L34 (= L33), S35 (≠ K34), T36 (≠ D35), G37 (= G36), D51 (= D49), I52 (≠ Y50), F73 (≠ E75), A74 (≠ G76), A75 (= A77), N92 (= N92), S115 (≠ A114), K145 (= K144), Y168 (= Y167), A171 (≠ V170), H184 (≠ A182)
- binding zinc ion: E182 (≠ S180), H184 (≠ A182), E187 (≠ A185), H189 (= H187)
2p5uA Crystal structure of thermus thermophilus hb8 udp-glucose 4-epimerase complex with NAD
31% identity, 80% coverage: 2:250/310 of query aligns to 3:259/311 of 2p5uA
- active site: T117 (≠ S116), G119 (≠ A118), A120 (≠ T119), Y143 (= Y140), K147 (= K144), H181 (≠ K178), G185 (≠ A182)
- binding nicotinamide-adenine-dinucleotide: G10 (= G9), F11 (= F10), I12 (= I11), D31 (= D31), N32 (= N32), L33 (= L33), A34 (≠ K34), T35 (≠ D35), G36 (= G36), D51 (= D49), L52 (≠ Y50), Q73 (≠ E75), A74 (≠ G76), A75 (= A77), A77 (≠ S79), S116 (= S115), Y143 (= Y140), K147 (= K144), V173 (= V170)
6zldA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-glucuronic acid and NAD (see paper)
27% identity, 76% coverage: 2:236/310 of query aligns to 3:243/314 of 6zldA
- active site: T126 (≠ S116), S127 (≠ A117), S128 (≠ A118), Y149 (= Y140), K153 (= K144)
- binding nicotinamide-adenine-dinucleotide: G7 (= G6), G10 (= G9), F11 (= F10), I12 (= I11), D32 (= D31), H33 (≠ N32), F34 (vs. gap), I35 (vs. gap), K43 (= K34), D62 (= D55), I63 (≠ F56), L81 (≠ E75), A82 (≠ G76), A83 (= A77), I124 (≠ A114), T126 (≠ S116), K153 (= K144), Y176 (= Y167), T178 (≠ N169), R185 (≠ M181), M188 (≠ V184)
- binding uridine-5'-diphosphate-glucuronic acid: P85 (≠ S79), R88 (vs. gap), T126 (≠ S116), S127 (≠ A117), S128 (≠ A118), Y149 (= Y140), F177 (= F168), T178 (≠ N169), R185 (≠ M181), M188 (≠ V184), A189 (= A185), R192 (≠ L188), T204 (≠ L200), F206 (≠ E202), Q211 (≠ F207), R213 (= R209)
Sites not aligning to the query:
6zl6A Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp and NAD (see paper)
27% identity, 76% coverage: 2:236/310 of query aligns to 3:243/314 of 6zl6A
- active site: T126 (≠ S116), S127 (≠ A117), S128 (≠ A118), Y149 (= Y140), K153 (= K144)
- binding nicotinamide-adenine-dinucleotide: G7 (= G6), G10 (= G9), F11 (= F10), I12 (= I11), D32 (= D31), H33 (≠ N32), F34 (vs. gap), I35 (vs. gap), K43 (= K34), D62 (= D55), I63 (≠ F56), L81 (≠ E75), A82 (≠ G76), A83 (= A77), I124 (≠ A114), T126 (≠ S116), K153 (= K144), Y176 (= Y167), T178 (≠ N169), V179 (= V170), R185 (≠ M181), M188 (≠ V184)
- binding uridine-5'-diphosphate: T178 (≠ N169), A189 (= A185), R192 (≠ L188), T204 (≠ L200), F206 (≠ E202), Q211 (≠ F207), R213 (= R209)
Sites not aligning to the query:
6zllA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-galacturonic acid and NAD (see paper)
27% identity, 76% coverage: 2:236/310 of query aligns to 3:243/321 of 6zllA
- active site: T126 (≠ S116), S127 (≠ A117), S128 (≠ A118), Y149 (= Y140), K153 (= K144)
- binding nicotinamide-adenine-dinucleotide: G7 (= G6), G10 (= G9), F11 (= F10), I12 (= I11), D32 (= D31), H33 (≠ N32), F34 (vs. gap), I35 (vs. gap), K43 (= K34), D62 (= D55), I63 (≠ F56), L81 (≠ E75), A82 (≠ G76), A83 (= A77), I124 (≠ A114), T126 (≠ S116), Y149 (= Y140), K153 (= K144), Y176 (= Y167), V179 (= V170), R185 (≠ M181), M188 (≠ V184)
- binding (2S,3R,4S,5R,6R)-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4,5-trihydroxy-oxane-2-carboxylic acid: P85 (≠ S79), V87 (≠ T81), R88 (vs. gap), T126 (≠ S116), S127 (≠ A117), Y149 (= Y140), T178 (≠ N169), R185 (≠ M181), A189 (= A185), R192 (≠ L188), T204 (≠ L200), F206 (≠ E202), Q211 (≠ F207), R213 (= R209)
Sites not aligning to the query:
- binding (2S,3R,4S,5R,6R)-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4,5-trihydroxy-oxane-2-carboxylic acid: 250, 276
6zljA Crystal structure of udp-glucuronic acid 4-epimerase y149f mutant from bacillus cereus in complex with udp-4-deoxy-4-fluoro-glucuronic acid and NAD (see paper)
27% identity, 76% coverage: 2:236/310 of query aligns to 3:243/314 of 6zljA
- active site: T126 (≠ S116), S127 (≠ A117), S128 (≠ A118), F149 (≠ Y140), K153 (= K144)
- binding nicotinamide-adenine-dinucleotide: G7 (= G6), G10 (= G9), F11 (= F10), I12 (= I11), D32 (= D31), H33 (≠ N32), F34 (vs. gap), I35 (vs. gap), K43 (= K34), D62 (= D55), I63 (≠ F56), L81 (≠ E75), A82 (≠ G76), A83 (= A77), I124 (≠ A114), T126 (≠ S116), K153 (= K144), Y176 (= Y167), T178 (≠ N169), V179 (= V170), R185 (≠ M181), M188 (≠ V184)
- binding (2~{R},3~{S},4~{R},5~{R},6~{R})-6-[[[(2~{R},3~{S},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3-fluoranyl-4,5-bis(oxidanyl)oxane-2-carboxylic acid: P85 (≠ S79), R88 (vs. gap), T126 (≠ S116), S127 (≠ A117), S128 (≠ A118), F149 (≠ Y140), F177 (= F168), T178 (≠ N169), R185 (≠ M181), M188 (≠ V184), A189 (= A185), R192 (≠ L188), T204 (≠ L200), F206 (≠ E202), Q211 (≠ F207), R213 (= R209)
Sites not aligning to the query:
- binding (2~{R},3~{S},4~{R},5~{R},6~{R})-6-[[[(2~{R},3~{S},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3-fluoranyl-4,5-bis(oxidanyl)oxane-2-carboxylic acid: 250, 276
6bwlA X-ray structure of pal from bacillus thuringiensis (see paper)
27% identity, 84% coverage: 2:262/310 of query aligns to 3:267/313 of 6bwlA
- active site: T122 (≠ S116), C123 (≠ A117), M124 (≠ A118), Y147 (= Y140), K151 (= K144)
- binding nicotinamide-adenine-dinucleotide: G7 (= G6), G10 (= G9), F11 (= F10), I12 (= I11), D31 (= D31), N32 (= N32), L33 (= L33), N35 (≠ D35), S36 (≠ G36), D57 (= D49), I58 (≠ Y50), L79 (≠ E75), A80 (≠ G76), A81 (= A77), I83 (≠ S79), M120 (≠ A114), K151 (= K144), N176 (= N169), T177 (≠ V170)
- binding uridine-5'-diphosphate: N176 (= N169), G189 (≠ A182), V190 (≠ S183), N205 (≠ L200), I206 (≠ F201), Y207 (≠ E202), Q212 (≠ F207), R214 (= R209), I250 (≠ F243)
Sites not aligning to the query:
Q564Q1 UDP-glucose 4-epimerase; Galactowaldenase; UDP-N-acetylgalactosamine 4-epimerase; UDP-GalNAc 4-epimerase; UDP-N-acetylglucosamine 4-epimerase; UDP-GlcNAc 4-epimerase; UDP-galactose 4-epimerase; EC 5.1.3.2; EC 5.1.3.7 from Caenorhabditis elegans (see paper)
27% identity, 80% coverage: 2:249/310 of query aligns to 3:286/349 of Q564Q1
Sites not aligning to the query:
- 314 P→L: In pv18; at the restrictive temperature of 25 degrees Celsius, embryos have cell-cell adhesion defects and die before hatching. The few surviving animals are arrested at the L1 larval stage. At the permissive temperature of 16-20 degrees Celsius, causes a developmental delay. Distal tip cell migration is impaired due to a reduced localization of metalloprotease mig-17 to the gonad basement membrane. Vulva lumen is smaller at the L4 larval stage. Accumulation of UDP-galactose (Gal) and reduction in UDP-N-acetylgalactosamine (GalNAc) levels. Hypersensitivity to a galactose-rich diet characterized by a slow development often resulting in an arrest at the L1 larval stage. Up-regulation of ER stress response protein hsp-4; expression is suppressed in an xbp-1 RNAi-mediated knockdown animals. Reduced survival upon E.faecalis or S.aureus-mediated infection.
Q7BJX9 UDP-N-acetylglucosamine 4-epimerase; UDP-GalNAc 4-epimerase; EC 5.1.3.7 from Plesiomonas shigelloides (Aeromonas shigelloides) (see 2 papers)
24% identity, 99% coverage: 3:308/310 of query aligns to 23:341/345 of Q7BJX9
- GVAGFI 26:31 (≠ GGAGFI 6:11) binding
- DNFSTG 50:55 (≠ DNLKDG 31:36) binding
- DI 81:82 (≠ NI 46:47) binding
- QAA 101:103 (≠ EGA 75:77) binding
- T120 (vs. gap) binding
- SS 145:146 (≠ SA 116:117) binding
- S147 (≠ A118) mutation to T: No effect on epimerase activity.
- Y169 (= Y140) binding
- K173 (= K144) binding
- YFN 196:198 (= YFN 167:169) binding
- V199 (= V170) binding
- VIPK 213:216 (≠ VAFH 184:187) binding
- YIN 228:230 (≠ FEG 201:203) binding
- S236 (≠ K208) mutation to G: No effect on epimerase activity.
- R237 (= R209) binding
- R271 (≠ A240) mutation to G: No effect on epimerase activity.
- RSGD 302:305 (vs. gap) binding
- R307 (vs. gap) mutation to A: No effect on epimerase activity.
- H308 (vs. gap) mutation to A: No effect on epimerase activity.
- S309 (≠ T276) mutation to Y: Abolishes epimerase activity.
Q9SA77 UDP-arabinose 4-epimerase 1; UDP-D-xylose 4-epimerase 1; EC 5.1.3.5 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
24% identity, 91% coverage: 2:284/310 of query aligns to 73:392/419 of Q9SA77
- G275 (vs. gap) mutation to D: In mur4-1; 50% reduction in L-Ara in cell wall material.
- R304 (= R209) mutation to Q: In mur4-3; 50% reduction in L-Ara in cell wall material.
Query Sequence
>BWI76_RS27260 FitnessBrowser__Koxy:BWI76_RS27260
MIIVTGGAGFIGSNIVKALNDQGITDILVVDNLKDGTKFINLVDLNIADYMDKEDFLIQI
MAGEEFGDIDAIFHEGACSSTTEWDGKYMMDNNYQYSKEVLHYCLEREIPFLYASSAATY
GGRTSDFIESREYEQPLNVYGYSKFLFDEYVRQILPEANSQIVGFRYFNVYGPREGHKGS
MASVAFHLNTQLNNGESPKLFEGSDGFKRDFVYVGDVAAVNLWFWENGVSGIFNLGTGRA
ESFQAVADATLAYHKKGSIEYIPFPDKLKGRYQAFTQADLTNLRAAGYDKPFKTVAEGVT
EYMAWLNRDA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory