Comparing BWI76_RS27590 FitnessBrowser__Koxy:BWI76_RS27590 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P31434 Alpha-xylosidase; EC 3.2.1.177 from Escherichia coli (strain K12) (see 2 papers)
86% identity, 100% coverage: 1:772/772 of query aligns to 1:772/772 of P31434
2f2hA Structure of the yici thiosugar michaelis complex (see paper)
86% identity, 100% coverage: 1:772/772 of query aligns to 1:772/773 of 2f2hA
1xskA Structure of a family 31 alpha glycosidase glycosyl-enzyme intermediate (see paper)
86% identity, 100% coverage: 1:772/772 of query aligns to 1:772/773 of 1xskA
6jr7A Flavobacterium johnsoniae gh31 dextranase, fjdex31a, complexed with glucose (see paper)
27% identity, 82% coverage: 102:735/772 of query aligns to 77:738/812 of 6jr7A
4kwuA 1.9 angstrom resolution crystal structure of uncharacterized protein lmo2446 from listeria monocytogenes egd-e in complex with alpha-d- glucose, beta-d-glucose, magnesium and calcium
27% identity, 75% coverage: 94:675/772 of query aligns to 176:804/1059 of 4kwuA
Sites not aligning to the query:
5hxmA Cycloalternan-forming enzyme from listeria monocytogenes in complex with panose (see paper)
27% identity, 75% coverage: 94:675/772 of query aligns to 177:805/1060 of 5hxmA
Sites not aligning to the query:
B3PEE6 Oligosaccharide 4-alpha-D-glucosyltransferase; Alpha-glucosidase 31B; CJAgd31B; EC 2.4.1.161 from Cellvibrio japonicus (strain Ueda107) (Pseudomonas fluorescens subsp. cellulosa) (see paper)
24% identity, 73% coverage: 83:645/772 of query aligns to 86:647/816 of B3PEE6
4ba0A Crystal structure of agd31b, alpha-transglucosylase, complexed with 5f-alpha-glcf (see paper)
25% identity, 73% coverage: 83:645/772 of query aligns to 52:611/781 of 4ba0A
7p4dAAA Oligosaccharide 4-alpha-D-glucosyltransferase (see paper)
24% identity, 73% coverage: 83:645/772 of query aligns to 52:610/780 of 7p4dAAA
Sites not aligning to the query:
7p4cAAA Oligosaccharide 4-alpha-D-glucosyltransferase (see paper)
24% identity, 73% coverage: 83:645/772 of query aligns to 52:610/780 of 7p4cAAA
Sites not aligning to the query:
5npeA Crystal structure of cjagd31b (alpha-transglucosylase from glycoside hydrolase family 31) in complex with beta cyclophellitol aziridine probe ky358 (see paper)
24% identity, 73% coverage: 83:645/772 of query aligns to 52:610/780 of 5npeA
Sites not aligning to the query:
5npbA Crystal structure of cjagd31b (alpha-transglucosylase from glycoside hydrolase family 31) in complex with alpha cyclophellitol cyclosulfate probe me647 (see paper)
24% identity, 73% coverage: 83:645/772 of query aligns to 52:610/780 of 5npbA
Sites not aligning to the query:
4b9zA Crystal structure of agd31b, alpha-transglucosylase, complexed with acarbose (see paper)
24% identity, 73% coverage: 83:645/772 of query aligns to 52:610/780 of 4b9zA
Sites not aligning to the query:
4b9yA Crystal structure of apo agd31b, alpha-transglucosylase in glycoside hydrolase family 31 (see paper)
24% identity, 73% coverage: 83:645/772 of query aligns to 52:610/780 of 4b9yA
Sites not aligning to the query:
5i24A Crystal structure of agd31b, alpha-transglucosylase in glycoside hydrolase family 31, in complex with cyclophellitol aziridine probe cf021 (see paper)
25% identity, 73% coverage: 83:645/772 of query aligns to 52:609/779 of 5i24A
5i23A Crystal structure of agd31b, alpha-transglucosylase in glycoside hydrolase family 31, in complex with cyclophellitol aziridine probe cf022 (see paper)
25% identity, 73% coverage: 83:645/772 of query aligns to 52:609/779 of 5i23A
5npdA Crystal structure of d412n nucleophile mutant cjagd31b (alpha- transglucosylase from glycoside hydrolase family 31) in complex with alpha cyclophellitol aziridine probe cf021 (see paper)
24% identity, 73% coverage: 83:645/772 of query aligns to 52:610/780 of 5npdA
Sites not aligning to the query:
5npcA Crystal structure of d412n nucleophile mutant cjagd31b (alpha- transglucosylase from glycoside hydrolase family 31) in complex with unreacted alpha cyclophellitol cyclosulfate probe me647 (see paper)
24% identity, 73% coverage: 83:645/772 of query aligns to 52:610/780 of 5npcA
Sites not aligning to the query:
5zn7A Crystal structure of gh31 alpha-xylosidase from a soil metagenome complexed with xylose
26% identity, 66% coverage: 153:665/772 of query aligns to 136:667/680 of 5zn7A
5ohtA A gh31 family sulfoquinovosidase from e. Coli in complex with aza- sugar inhibitor ifgsq (see paper)
24% identity, 68% coverage: 140:667/772 of query aligns to 98:657/670 of 5ohtA
>BWI76_RS27590 FitnessBrowser__Koxy:BWI76_RS27590
MKISDGNWLIQPGLNLIQPVQVYEVEQQGNEMVVYVASREVRERAAQLDVPLFTVRFFSP
QEGVIGVRMEHFQGALNNGPHYPLNVVKDVKVEIHNGAEFAELKSGNLTARVTKGDFWSL
DFLRDGVRITGSQLKNDGYVQDTKTNRNYMFERLDLGVGDTVYGLGERFTALVRNGQTVD
TWNEDGGTSTEQSYKNIPFYLTNRGYGVLVNHPERVSFEIGSEKVSKVQFSVEGEHLEYF
VIDGPTPKEVLNRYTRFTGRPALPPAWSFGLWLTTSFTTNYDEATVNRFIDGMAERNLPL
HVFHFDCFWMKAFQWCDFEWDPLTFPDPEGMIKRLKEKGLKVCVWINPYIGQRSPVFKEL
QEKGYLLKRPDGSLWQWDKWQPGLAIYDFTNPQACQWYADKLKGLVAMGVDCFKTDFGER
IPTDVQWFDGSDPQKMHNHYAFIYNELVWNVLKETVGEKEAVLFARSASVGAQQFPVHWG
GDCYANYESMAESLRGGLSIGMSGFGFWSHDIGGFENTAPAHVYKRWCAFGLLSSHSRLH
GSKSYRVPWAYDDESCDVVRHFTQLKCRMMPYLYRQAALANEFGTPMLRSMMLEFPHDPA
CDYLDRQYMLGDSVLVAPVFSEAGDVQFWLPEGRWTHLWRNDEAQGSRWHKQNHDVLSLP
VYVRDNTLLALGNNDQKPDYAWNEGTAFQLFNLDDGREAVCQVPAADGSVVFTLKAKRQG
NAITVCGEGKASGWTLCLRNIQQVAGVQGGAQAGSELGVVVTAQGNALTITL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory