SitesBLAST
Comparing CA265_RS00760 FitnessBrowser__Pedo557:CA265_RS00760 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4za2D Crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d- gluconate dehydrogenase complexed with NAD+ (see paper)
47% identity, 99% coverage: 3:254/254 of query aligns to 4:247/247 of 4za2D
- binding nicotinamide-adenine-dinucleotide: G17 (= G16), D19 (≠ K18), L22 (≠ I21), I42 (≠ A41), D65 (= D67), M66 (≠ F68), N92 (= N94), A93 (= A95), G94 (= G96), L115 (≠ V117), I143 (≠ T144), S145 (= S146), Y158 (= Y159), K162 (= K163), G189 (= G190), M191 (≠ I192), T193 (= T194), N195 (= N196)
3uf0A Crystal structure of a putative NAD(p) dependent gluconate 5- dehydrogenase from beutenbergia cavernae(efi target efi-502044) with bound NADP (low occupancy)
49% identity, 98% coverage: 5:252/254 of query aligns to 3:247/249 of 3uf0A
- active site: G18 (= G20), S141 (= S146), V151 (= V156), Y154 (= Y159), K158 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G16), S17 (≠ R19), G18 (= G20), I19 (= I21), R39 (≠ A41), D63 (= D67), L64 (≠ F68), N89 (= N94), G91 (= G96), I92 (≠ T97), I139 (≠ T144), A140 (= A145), S141 (= S146), Y154 (= Y159), K158 (= K163), P184 (= P189), G185 (= G190), V187 (≠ I192), T189 (= T194), N191 (= N196), T192 (= T197)
4hp8B Crystal structure of a putative 2-deoxy-d-gluconate 3-dehydrogenase from agrobacterium tumefaciens (target efi-506435) with bound NADP
51% identity, 99% coverage: 3:254/254 of query aligns to 2:246/246 of 4hp8B
- active site: G19 (= G20), S138 (= S146), V148 (= V156), Y151 (= Y159), K155 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G16), N17 (≠ K18), T18 (≠ R19), G19 (= G20), L20 (≠ I21), R40 (≠ L43), R41 (≠ E44), D63 (= D67), F64 (= F68), N85 (= N94), G87 (= G96), I88 (≠ T97), I136 (≠ T144), Y151 (= Y159), K155 (= K163), P181 (= P189), G182 (= G190), I184 (= I192), T186 (= T194), N188 (= N196), T189 (= T197)
3o03A Quaternary complex structure of gluconate 5-dehydrogenase from streptococcus suis type 2 (see paper)
43% identity, 98% coverage: 5:252/254 of query aligns to 7:247/254 of 3o03A
- active site: G22 (= G20), S147 (= S146), V157 (= V156), Y160 (= Y159), K164 (= K163)
- binding calcium ion: S147 (= S146), M148 (≠ L147), P190 (= P189)
- binding D-gluconic acid: I99 (= I98), R101 (= R100), S147 (= S146), M149 (≠ L148), R154 (≠ G153), Y160 (= Y159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G16), Y21 (≠ R19), G22 (= G20), I23 (= I21), D42 (≠ S40), I43 (≠ A41), L47 (= L45), D68 (= D67), V69 (≠ F68), N95 (= N94), A96 (= A95), G97 (= G96), I145 (≠ T144), Y160 (= Y159), K164 (= K163), P190 (= P189)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
39% identity, 98% coverage: 4:251/254 of query aligns to 1:249/252 of 1vl8B
- active site: G17 (= G20), S143 (= S146), I154 (vs. gap), Y157 (= Y159), K161 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G16), R16 (= R19), G17 (= G20), L18 (≠ I21), S37 (= S40), R38 (≠ A41), C63 (= C66), D64 (= D67), V65 (≠ F68), A91 (≠ N94), A92 (= A95), G93 (= G96), I94 (≠ T97), V114 (= V117), I141 (≠ T144), S143 (= S146), Y157 (= Y159), K161 (= K163), P187 (= P189), G188 (= G190), Y190 (≠ I192), T192 (= T194), M194 (≠ N196), T195 (= T197)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
38% identity, 98% coverage: 5:252/254 of query aligns to 1:246/247 of 4jroC
- active site: G16 (= G20), S142 (= S146), Q152 (≠ V156), Y155 (= Y159), K159 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G16), S14 (≠ K18), R15 (= R19), G16 (= G20), I17 (= I21), N35 (≠ V39), Y36 (≠ S40), N37 (≠ A41), G38 (≠ S42), S39 (≠ L43), N63 (≠ D67), V64 (≠ F68), N90 (= N94), A91 (= A95), I93 (≠ T97), I113 (≠ V117), S142 (= S146), Y155 (= Y159), K159 (= K163), P185 (= P189), I188 (= I192), T190 (= T194)
5u9pB Crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP and tartrate
40% identity, 97% coverage: 5:250/254 of query aligns to 12:256/261 of 5u9pB
- active site: G27 (= G20), S152 (= S146), Y165 (= Y159), K169 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G16), R26 (= R19), G27 (= G20), I28 (= I21), R48 (≠ S42), D73 (≠ G69), V74 (≠ K70), N100 (= N94), A101 (= A95), I150 (≠ T144), Y165 (= Y159), K169 (= K163), P195 (= P189), F198 (≠ I192), T200 (= T194), L202 (≠ N196), N203 (≠ T197)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
38% identity, 98% coverage: 2:251/254 of query aligns to 1:244/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G16), S17 (≠ K18), R18 (= R19), I20 (= I21), T40 (≠ A41), N62 (≠ D67), V63 (≠ F68), N89 (= N94), A90 (= A95), I92 (≠ T97), V139 (≠ T144), S141 (= S146), Y154 (= Y159), K158 (= K163), P184 (= P189), G185 (= G190), I187 (= I192), T189 (= T194), M191 (≠ N196)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
36% identity, 97% coverage: 5:251/254 of query aligns to 1:241/244 of P0AEK2
- GASR 12:15 (≠ GCKR 16:19) binding
- T37 (≠ A41) binding
- NV 59:60 (≠ YQ 64:65) binding
- N86 (= N94) binding
- Y151 (= Y159) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YAASK 159:163) binding
- A154 (≠ S162) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K163) mutation to A: Defect in the affinity for NADPH.
- I184 (= I192) binding
- E233 (≠ T243) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
37% identity, 97% coverage: 6:251/254 of query aligns to 1:240/243 of 1q7bA
- active site: G15 (= G20), E101 (≠ Y110), S137 (= S146), Q147 (≠ V156), Y150 (= Y159), K154 (= K163)
- binding calcium ion: E232 (≠ T243), T233 (≠ I244)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G16), S13 (≠ K18), R14 (= R19), T36 (≠ A41), N58 (≠ Y64), V59 (≠ Q65), N85 (= N94), A86 (= A95), G87 (= G96), I88 (≠ T97), S137 (= S146), Y150 (= Y159), K154 (= K163), P180 (= P189), G181 (= G190), I183 (= I192)
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
36% identity, 97% coverage: 6:251/254 of query aligns to 1:240/243 of 1q7cA
- active site: G15 (= G20), S137 (= S146), Q147 (≠ V156), F150 (≠ Y159), K154 (= K163)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G16), S13 (≠ K18), R14 (= R19), A35 (≠ S40), T36 (≠ A41), L57 (≠ A63), N58 (≠ Y64), V59 (≠ Q65), G87 (= G96), I88 (≠ T97)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
36% identity, 97% coverage: 5:251/254 of query aligns to 1:241/244 of 6t77A
- active site: G16 (= G20), S138 (= S146), Y151 (= Y159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G16), S14 (≠ K18), R15 (= R19), T37 (≠ A41), L58 (≠ A63), N59 (≠ Y64), V60 (≠ Q65), A87 (= A95), G88 (= G96), I89 (≠ T97)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
37% identity, 98% coverage: 2:251/254 of query aligns to 1:240/243 of 4i08A
- active site: G19 (= G20), N113 (= N118), S141 (= S146), Q151 (≠ V156), Y154 (= Y159), K158 (= K163)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G16), S17 (≠ K18), R18 (= R19), I20 (= I21), T40 (≠ A41), N62 (≠ D67), V63 (≠ F68), N89 (= N94), A90 (= A95), G140 (≠ A145), S141 (= S146), Y154 (= Y159), K158 (= K163), P184 (= P189), G185 (= G190), T189 (= T194)
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
37% identity, 94% coverage: 13:250/254 of query aligns to 5:241/244 of 1edoA
- active site: G12 (= G20), S138 (= S146), Y151 (= Y159), K155 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G16), S10 (≠ K18), R11 (= R19), I13 (= I21), N31 (≠ V39), Y32 (≠ S40), A33 (= A41), R34 (≠ S42), S35 (≠ L43), D59 (= D67), V60 (≠ F68), N86 (= N94), A87 (= A95), S138 (= S146), Y151 (= Y159), K155 (= K163), P181 (= P189), G182 (= G190), I184 (= I192), S186 (≠ T194), M188 (≠ N196)
3lqfA Crystal structure of the short-chain dehydrogenase galactitol- dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD and erythritol (see paper)
40% identity, 98% coverage: 3:251/254 of query aligns to 5:251/254 of 3lqfA
- active site: G22 (= G20), S144 (= S149), Y159 (= Y159), K163 (= K163)
- binding meso-erythritol: N151 (vs. gap), Y159 (= Y159), Y191 (= Y191), T197 (= T197), M200 (≠ L200)
- binding nicotinamide-adenine-dinucleotide: G18 (= G16), S21 (≠ R19), G22 (= G20), I23 (= I21), D42 (≠ E44), R43 (≠ L45), D66 (= D67), V67 (≠ F68), S92 (≠ N94), L142 (= L147), S144 (= S149), K163 (= K163), P189 (= P189), V192 (≠ I192), T194 (= T194), M196 (≠ N196), T197 (= T197)
2wsbA Crystal structure of the short-chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD (see paper)
40% identity, 98% coverage: 3:251/254 of query aligns to 5:251/254 of 2wsbA
- active site: G22 (= G20), S144 (= S149), Y159 (= Y159), K163 (= K163)
- binding nicotinamide-adenine-dinucleotide: G18 (= G16), S21 (≠ R19), G22 (= G20), I23 (= I21), D42 (≠ E44), R43 (≠ L45), D66 (= D67), V67 (≠ F68), S92 (≠ N94), A93 (= A95), L142 (= L147), S144 (= S149), Y159 (= Y159), K163 (= K163), P189 (= P189), V192 (≠ I192), T194 (= T194), M196 (≠ N196), T197 (= T197)
- binding n-propanol: S144 (= S149), M145 (≠ F150), N151 (vs. gap), N151 (vs. gap), Y159 (= Y159), Y159 (= Y159), Y191 (= Y191)
2wdzA Crystal structure of the short chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD+ and 1,2-pentandiol (see paper)
40% identity, 98% coverage: 3:251/254 of query aligns to 5:251/254 of 2wdzA
- active site: G22 (= G20), S144 (= S149), Y159 (= Y159), K163 (= K163)
- binding (2S)-pentane-1,2-diol: A45 (≠ G47), D49 (≠ E51), R62 (vs. gap), S146 (≠ Q151), Y159 (= Y159)
- binding nicotinamide-adenine-dinucleotide: G18 (= G16), S21 (≠ R19), G22 (= G20), I23 (= I21), D42 (≠ E44), R43 (≠ L45), A65 (≠ C66), D66 (= D67), V67 (≠ F68), S92 (≠ N94), A93 (= A95), L142 (= L147), S144 (= S149), Y159 (= Y159), K163 (= K163), P189 (= P189), V192 (≠ I192), T194 (= T194), M196 (≠ N196), T197 (= T197)
C0KTJ6 Galactitol 2-dehydrogenase (L-tagatose-forming); Galactitol dehydrogenase; GDH; GatDH; Galactitol:NAD(+) 5-oxidoreductase; EC 1.1.1.406 from Cereibacter sphaeroides (Rhodobacter sphaeroides) (see paper)
40% identity, 98% coverage: 3:251/254 of query aligns to 5:251/254 of C0KTJ6
Sites not aligning to the query:
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
35% identity, 97% coverage: 5:251/254 of query aligns to 1:241/244 of P0A2C9
- M125 (= M133) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (= A233) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S234) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
7emgB Carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with NADP+ (see paper)
36% identity, 96% coverage: 9:251/254 of query aligns to 4:240/243 of 7emgB
Query Sequence
>CA265_RS00760 FitnessBrowser__Pedo557:CA265_RS00760
MSNIFNLAGKTALVTGCKRGIGKAMALALAEAGADIIGVSASLELQGSAVEKEILALGRK
FYAYQCDFGKRENTLAFAAQVKADHPVIDILVNNAGTILRQPIAEHSDEYWDEVIAVNQT
APFILTREIGREMIARGSGKVIFTASLLSFQGGITVPGYAASKGAIASLTKAFANEWASK
GVNVNAIAPGYIATDNTSALREDQDRSTSILSRIPAGRWGTPEDFKGPTLFLASPASDYV
HGTILTVDGGWMGR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory