Comparing CA265_RS04210 FitnessBrowser__Pedo557:CA265_RS04210 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
7bywA Crystal structure of acidovorax avenae l-fucose mutarotase (l-fucose- bound form) (see paper)
50% identity, 74% coverage: 40:149/149 of query aligns to 2:108/108 of 7bywA
1x8dA Crystal structure of e. Coli yiil protein containing l-rhamnose (see paper)
25% identity, 74% coverage: 38:147/149 of query aligns to 1:102/104 of 1x8dA
P32156 L-rhamnose mutarotase; Rhamnose 1-epimerase; Type-3 mutarotase; EC 5.1.3.32 from Escherichia coli (strain K12) (see paper)
25% identity, 74% coverage: 38:147/149 of query aligns to 1:102/104 of P32156
>CA265_RS04210 FitnessBrowser__Pedo557:CA265_RS04210
MKILKAMYFLALAFVLMASACNPPAKNDSKSSNTANKVLRYGSITGLKPEKMAYYKKLHT
AAWPGVLKKITECNIHNYSIYLKEIEGKPYLFSYFEYTGTDFAADMKKMAADTTTQRWWK
ETAPSQIPLPDAAAKGETWSAMEEVFHHD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory