SitesBLAST
Comparing CA265_RS04665 FitnessBrowser__Pedo557:CA265_RS04665 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4gvxA Crystal structure of a short chain dehydrogenase homolog (target efi- 505321) from burkholderia multivorans, with bound NADP and l-fucose
52% identity, 100% coverage: 1:260/260 of query aligns to 1:258/258 of 4gvxA
- active site: G18 (= G18), S140 (= S142), T150 (= T152), Y153 (= Y155), K157 (≠ N159), W194 (= W196)
- binding beta-L-fucopyranose: N94 (= N95), S140 (= S142), K141 (= K143), Q147 (= Q149), Y153 (= Y155), A184 (= A186), E185 (= E187), Y191 (= Y193), W194 (= W196)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G14), S17 (≠ K17), G18 (= G18), I19 (= I19), R39 (= R39), H40 (≠ N40), E63 (= E64), L64 (= L65), N90 (= N91), I138 (= I140), S139 (≠ G141), S140 (= S142), Y153 (= Y155), K157 (≠ N159), P183 (≠ V185), V186 (≠ A188), T188 (= T190), L190 (= L192), Y191 (= Y193)
4gloA Crystal structure of a short chain dehydrogenase homolog (target efi- 505321) from burkholderia multivorans, with bound NAD
52% identity, 100% coverage: 1:260/260 of query aligns to 1:258/258 of 4gloA
- active site: G18 (= G18), S140 (= S142), T150 (= T152), Y153 (= Y155), K157 (≠ N159)
- binding nicotinamide-adenine-dinucleotide: G14 (= G14), I19 (= I19), A38 (≠ G38), R39 (= R39), V62 (≠ A63), E63 (= E64), L64 (= L65), N90 (= N91), A91 (= A92), I138 (= I140), S139 (≠ G141), S140 (= S142), Y153 (= Y155), K157 (≠ N159), P183 (≠ V185), V186 (≠ A188), L190 (= L192)
4gkbB Crystal structure of a short chain dehydrogenase homolog (target efi- 505321) from burkholderia multivorans, unliganded structure
52% identity, 100% coverage: 1:260/260 of query aligns to 1:258/258 of 4gkbB
A0A0H3KNE7 L-fucose dehydrogenase; EC 1.1.1.435 from Burkholderia multivorans (strain ATCC 17616 / 249) (see paper)
52% identity, 100% coverage: 1:260/260 of query aligns to 1:258/258 of A0A0H3KNE7
- S17 (≠ K17) binding
- I19 (= I19) binding
- R39 (= R39) binding
- H40 (≠ N40) binding
- E63 (= E64) binding
- L64 (= L65) binding
- N90 (= N91) binding
- N94 (= N95) binding
- S140 (= S142) binding
- K141 (= K143) binding
- Q147 (= Q149) binding
- Y153 (= Y155) binding ; binding
- K157 (≠ N159) binding
- A184 (= A186) binding
- E185 (= E187) binding
- V186 (≠ A188) binding
- T188 (= T190) binding
6ds1B Crystal structure of cj0485 dehydrogenase in complex with NADP+ (see paper)
44% identity, 100% coverage: 1:259/260 of query aligns to 1:257/260 of 6ds1B
- binding magnesium ion: I61 (≠ A63), D62 (≠ E64)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G14), K17 (= K17), G18 (= G18), I19 (= I19), S38 (≠ G38), R39 (= R39), D62 (≠ E64), L63 (= L65), N89 (= N91), A90 (= A92), I138 (= I140), V139 (≠ G141), S140 (= S142), Y153 (= Y155), K157 (≠ N159), P183 (≠ V185), A184 (= A186), V186 (≠ A188)
7wbcA Hydroxysteroid dehydrogenase wild-type complexed with NAD+ and (4s)-2- 2-methyl-2,4-pentanediol
33% identity, 97% coverage: 3:255/260 of query aligns to 1:249/250 of 7wbcA
- binding calcium ion: Y115 (≠ V117), P116 (≠ H118), H119 (≠ L121)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), G16 (= G18), I17 (= I19), D36 (≠ G38), V37 (≠ R39), A61 (= A63), D62 (≠ E64), I63 (≠ L65), N89 (= N91), F138 (≠ I140), S140 (= S142), Y153 (= Y155), K157 (≠ N159), P183 (≠ A186), F184 (≠ E187), A185 (= A188), T187 (= T190), G189 (≠ L192), V190 (≠ Y193)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
31% identity, 96% coverage: 3:252/260 of query aligns to 2:249/252 of 1vl8B
- active site: G17 (= G18), S143 (= S142), I154 (≠ T152), Y157 (= Y155), K161 (≠ N159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), R16 (≠ K17), G17 (= G18), L18 (≠ I19), S37 (≠ G38), R38 (= R39), C63 (≠ A63), D64 (≠ E64), V65 (≠ L65), A91 (≠ N91), A92 (= A92), G93 (= G93), I94 (≠ V94), V114 (≠ K114), I141 (= I140), S143 (= S142), Y157 (= Y155), K161 (≠ N159), P187 (≠ E187), G188 (≠ A188), Y190 (≠ L192), T192 (≠ E194), M194 (≠ W196), T195 (≠ I197)
3i3oA 2.06 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'Ames ancestor' in complex with NAD-acetone
34% identity, 96% coverage: 5:253/260 of query aligns to 36:279/282 of 3i3oA
- active site: G49 (= G18), S174 (= S142), L184 (≠ T152), Y187 (= Y155), K191 (≠ N159), K232 (≠ R203)
- binding magnesium ion: D47 (≠ A16), S48 (≠ K17), E72 (≠ N40)
- binding nicotinamide adenine dinucleotide acetone adduct: G45 (= G14), D47 (≠ A16), S48 (≠ K17), G49 (= G18), I50 (= I19), Y69 (≠ I37), L70 (≠ G38), E72 (≠ N40), G95 (≠ A63), D96 (≠ E64), L97 (= L65), N123 (= N91), V124 (vs. gap), A125 (= A92), Q126 (≠ G93), Q127 (≠ V94), I147 (≠ K114), T172 (≠ I140), S174 (= S142), Y187 (= Y155), K191 (≠ N159), P217 (≠ V185), G218 (≠ A186), I220 (≠ A188), T222 (= T190), L224 (= L192)
3ijrF 2.05 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'Ames ancestor' in complex with NAD+
34% identity, 96% coverage: 5:253/260 of query aligns to 44:287/290 of 3ijrF
- active site: G57 (= G18), S182 (= S142), L192 (≠ T152), Y195 (= Y155), K199 (≠ N159), K240 (≠ R203)
- binding magnesium ion: D55 (≠ A16), S56 (≠ K17), E80 (≠ N40)
- binding nicotinamide-adenine-dinucleotide: D55 (≠ A16), S56 (≠ K17), G57 (= G18), I58 (= I19), Y77 (≠ I37), L78 (≠ G38), E80 (≠ N40), G103 (≠ A63), D104 (≠ E64), L105 (= L65), N131 (= N91), V132 (vs. gap), A133 (= A92), Q134 (≠ G93), I155 (≠ K114), T180 (≠ I140), S182 (= S142), Y195 (= Y155), K199 (≠ N159), P225 (≠ V185), G226 (≠ A186), P227 (≠ E187), I228 (≠ A188), T230 (= T190), L232 (= L192)
Sites not aligning to the query:
6zt2A 17beta-hydroxysteroid dehydrogenase type 14 variant s205 in complex with 3-chloro-2,6-difluorophenol
31% identity, 88% coverage: 24:251/260 of query aligns to 22:244/252 of 6zt2A
- binding beta-D-glucopyranose: W184 (= W189), T185 (= T190), P186 (= P191), E189 (= E194)
- binding nicotinamide-adenine-dinucleotide: D36 (≠ G38), K37 (≠ R39), D58 (≠ E64), V59 (≠ L65), N85 (= N91), L109 (≠ K114), S137 (= S142), Y150 (= Y155), K154 (≠ N159), P180 (≠ V185), G181 (≠ A186), N182 (≠ E187), I183 (≠ A188), T185 (= T190), L187 (= L192)
- binding 3-chloranyl-2,6-bis(fluoranyl)phenol: H89 (≠ N95), S137 (= S142), Y150 (= Y155), N182 (≠ E187), W188 (≠ Y193)
Sites not aligning to the query:
6zdiA 17beta-hydroxysteroid dehydrogenase type 14 variant s205 in complex with 2-fluoro-5-nitrophenol
31% identity, 88% coverage: 24:251/260 of query aligns to 22:244/252 of 6zdiA
- active site: S137 (= S142), Y150 (= Y155), K154 (≠ N159)
- binding nicotinamide-adenine-dinucleotide: D36 (≠ G38), K37 (≠ R39), D58 (≠ E64), V59 (≠ L65), N85 (= N91), A86 (= A92), L109 (≠ K114), I135 (= I140), S137 (= S142), Y150 (= Y155), K154 (≠ N159), P180 (≠ V185), G181 (≠ A186), N182 (≠ E187), I183 (≠ A188), T185 (= T190), L187 (= L192)
- binding 2-fluoranyl-5-nitro-phenol: H89 (≠ N95), S137 (= S142), Y150 (= Y155), L187 (= L192), W188 (≠ Y193), L191 (≠ W196)
Sites not aligning to the query:
6zdeA 17beta-hydroxysteroid dehydrogenase type 14 variant s205 in complex with pentafluorophenol
31% identity, 88% coverage: 24:251/260 of query aligns to 22:244/252 of 6zdeA
- active site: S137 (= S142), Y150 (= Y155), K154 (≠ N159)
- binding nicotinamide-adenine-dinucleotide: D36 (≠ G38), K37 (≠ R39), D58 (≠ E64), V59 (≠ L65), N85 (= N91), L109 (≠ K114), S137 (= S142), Y150 (= Y155), K154 (≠ N159), P180 (≠ V185), G181 (≠ A186), N182 (≠ E187), I183 (≠ A188), T185 (= T190), L187 (= L192)
- binding 2,3,4,5,6-pentakis(fluoranyl)phenol: H89 (≠ N95), S137 (= S142), Y150 (= Y155), L187 (= L192), W188 (≠ Y193)
Sites not aligning to the query:
5en4A Complex of 17-beta-hydroxysteroid dehydrogenase type 14 with inhibitor. (see paper)
31% identity, 88% coverage: 24:251/260 of query aligns to 23:245/251 of 5en4A
- active site: S138 (= S142), A148 (≠ T152), Y151 (= Y155), K155 (≠ N159)
- binding [2,3-bis(oxidanyl)phenyl]-[6-(2-fluoranyl-3-oxidanyl-phenyl)pyridin-2-yl]methanone: H90 (≠ N95), S138 (= S142), Q145 (= Q149), A146 (≠ G150), Q147 (≠ G151), Y151 (= Y155), N183 (≠ E187), W189 (≠ Y193), L192 (≠ W196)
- binding nicotinamide-adenine-dinucleotide: D37 (≠ G38), K38 (≠ R39), D59 (≠ E64), V60 (≠ L65), N86 (= N91), L110 (≠ K114), S138 (= S142), Y151 (= Y155), K155 (≠ N159), P181 (≠ V185), G182 (≠ A186), I184 (≠ A188), T186 (= T190), L188 (= L192)
Sites not aligning to the query:
5l7wA 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with a non-steroidal inhibitor. (see paper)
31% identity, 88% coverage: 24:251/260 of query aligns to 23:245/254 of 5l7wA
- active site: S138 (= S142), A148 (≠ T152), Y151 (= Y155), K155 (≠ N159)
- binding [4-fluoranyl-2,3-bis(oxidanyl)phenyl]-[6-(2-fluoranyl-3-oxidanyl-phenyl)pyridin-2-yl]methanone: H90 (≠ N95), S138 (= S142), Q145 (= Q149), A146 (≠ G150), Q147 (≠ G151), Y151 (= Y155), N183 (≠ E187), W189 (≠ Y193), L192 (≠ W196)
- binding beta-D-glucopyranose: W185 (= W189), T186 (= T190), P187 (= P191), E190 (= E194)
- binding nicotinamide-adenine-dinucleotide: D37 (≠ G38), K38 (≠ R39), D59 (≠ E64), V60 (≠ L65), N86 (= N91), A87 (= A92), G88 (= G93), L110 (≠ K114), S138 (= S142), Y151 (= Y155), K155 (≠ N159), P181 (≠ V185), G182 (≠ A186), N183 (≠ E187), I184 (≠ A188), T186 (= T190), L188 (= L192)
Sites not aligning to the query:
6gtbA 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with fb211
31% identity, 88% coverage: 24:251/260 of query aligns to 23:245/257 of 6gtbA
- active site: S138 (= S142), Y151 (= Y155), K155 (≠ N159)
- binding beta-D-glucopyranose: W185 (= W189), T186 (= T190), P187 (= P191), E190 (= E194)
- binding 3-[6-(3-hydroxyphenyl)pyridin-2-yl]benzoic acid: H90 (≠ N95), P93 (≠ V98), S138 (= S142), Q145 (= Q149), A146 (≠ G150), Q147 (≠ G151), Y151 (= Y155), W189 (≠ Y193), L192 (≠ W196), M196 (≠ F200)
- binding nicotinamide-adenine-dinucleotide: D37 (≠ G38), K38 (≠ R39), D59 (≠ E64), V60 (≠ L65), N86 (= N91), L110 (≠ K114), S138 (= S142), Y151 (= Y155), K155 (≠ N159), P181 (≠ V185), G182 (≠ A186), N183 (≠ E187), I184 (≠ A188), T186 (= T190), L188 (= L192)
Sites not aligning to the query:
5o7cA 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with a non-steroidal quinoline based inhibitor (see paper)
31% identity, 88% coverage: 24:251/260 of query aligns to 23:245/257 of 5o7cA
- active site: S138 (= S142), Y151 (= Y155), K155 (≠ N159)
- binding 2-(4-fluoranyl-3-oxidanyl-phenyl)carbonylquinoline-7-carbonitrile: H90 (≠ N95), P93 (≠ V98), S138 (= S142), Y151 (= Y155), N183 (≠ E187), W189 (≠ Y193), L192 (≠ W196), T202 (≠ K206)
- binding beta-D-glucopyranose: W185 (= W189), T186 (= T190), P187 (= P191), E190 (= E194)
- binding nicotinamide-adenine-dinucleotide: D37 (≠ G38), K38 (≠ R39), D59 (≠ E64), V60 (≠ L65), N86 (= N91), A87 (= A92), L110 (≠ K114), S138 (= S142), Y151 (= Y155), K155 (≠ N159), P181 (≠ V185), G182 (≠ A186), N183 (≠ E187), I184 (≠ A188), T186 (= T190), L188 (= L192)
Sites not aligning to the query:
5o6zA 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with a non-steroidal quinoline based inhibitor (see paper)
31% identity, 88% coverage: 24:251/260 of query aligns to 23:245/257 of 5o6zA
- active site: S138 (= S142), Y151 (= Y155), K155 (≠ N159)
- binding (4-fluoranyl-3-oxidanyl-phenyl)-quinolin-2-yl-methanone: H90 (≠ N95), S138 (= S142), Y151 (= Y155), N183 (≠ E187), W189 (≠ Y193), L192 (≠ W196)
- binding beta-D-glucopyranose: W185 (= W189), T186 (= T190), P187 (= P191), E190 (= E194)
- binding nicotinamide-adenine-dinucleotide: D37 (≠ G38), K38 (≠ R39), D59 (≠ E64), V60 (≠ L65), N86 (= N91), L110 (≠ K114), S138 (= S142), Y151 (= Y155), K155 (≠ N159), P181 (≠ V185), G182 (≠ A186), I184 (≠ A188), T186 (= T190), L188 (= L192)
Sites not aligning to the query:
5o6oA 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with a non-steroidal 2,6-pyridinketone inhibitor (see paper)
31% identity, 88% coverage: 24:251/260 of query aligns to 23:245/256 of 5o6oA
- active site: S138 (= S142), Y151 (= Y155), K155 (≠ N159)
- binding 2-fluoranyl-3-[6-(4-fluoranyl-3-oxidanyl-phenoxy)pyridin-2-yl]phenol: H90 (≠ N95), S138 (= S142), Q145 (= Q149), A146 (≠ G150), Q147 (≠ G151), Y151 (= Y155), N183 (≠ E187), W189 (≠ Y193), L192 (≠ W196)
- binding beta-D-glucopyranose: W185 (= W189), T186 (= T190), P187 (= P191), E190 (= E194)
- binding nicotinamide-adenine-dinucleotide: D37 (≠ G38), K38 (≠ R39), D59 (≠ E64), V60 (≠ L65), N86 (= N91), L110 (≠ K114), S138 (= S142), Y151 (= Y155), K155 (≠ N159), P181 (≠ V185), G182 (≠ A186), N183 (≠ E187), I184 (≠ A188), T186 (= T190), L188 (= L192)
Sites not aligning to the query:
5o42A 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with a non-steroidal 2,6-pyridinketone inhibitor. (see paper)
31% identity, 88% coverage: 24:251/260 of query aligns to 23:245/256 of 5o42A
- active site: S138 (= S142), Y151 (= Y155), K155 (≠ N159)
- binding 2-fluoranyl-3-[6-[1-(4-fluoranyl-3-oxidanyl-phenyl)ethenyl]pyridin-2-yl]phenol: H90 (≠ N95), P93 (≠ V98), S138 (= S142), Q145 (= Q149), A146 (≠ G150), Y151 (= Y155), N183 (≠ E187), W189 (≠ Y193), L192 (≠ W196)
- binding beta-D-glucopyranose: W185 (= W189), T186 (= T190), P187 (= P191), E190 (= E194)
- binding nicotinamide-adenine-dinucleotide: D37 (≠ G38), K38 (≠ R39), D59 (≠ E64), V60 (≠ L65), N86 (= N91), G88 (= G93), L110 (≠ K114), S138 (= S142), Y151 (= Y155), K155 (≠ N159), P181 (≠ V185), G182 (≠ A186), N183 (≠ E187), I184 (≠ A188), T186 (= T190), L188 (= L192)
Sites not aligning to the query:
5hs6A Human 17beta-hydroxysteroid dehydrogenase type 14 in complex with estrone (see paper)
31% identity, 88% coverage: 24:251/260 of query aligns to 23:245/257 of 5hs6A
- active site: S138 (= S142), A148 (≠ T152), Y151 (= Y155), K155 (≠ N159)
- binding (9beta,13alpha)-3-hydroxyestra-1,3,5(10)-trien-17-one: H90 (≠ N95), Q145 (= Q149), Y151 (= Y155), L192 (≠ W196)
- binding nicotinamide-adenine-dinucleotide: D37 (≠ G38), K38 (≠ R39), D59 (≠ E64), N86 (= N91), L110 (≠ K114), S138 (= S142), Y151 (= Y155), K155 (≠ N159), P181 (≠ V185), G182 (≠ A186), N183 (≠ E187), I184 (≠ A188), T186 (= T190), L188 (= L192)
Sites not aligning to the query:
Query Sequence
>CA265_RS04665 FitnessBrowser__Pedo557:CA265_RS04665
MNLNLDGKIILVSGGAKGIGAAIVKALAIENAFPIIIGRNENDNLKMLQEITDLGLKADY
FTAELTAPESCKTIVDAILAKYGRIDGLVNNAGVNDGVGLENGTYEGFMESLHKNVVHYY
LLAKHALPALKQSKGSILNIGSKTAETGQGGTSGYAASNGARNALTREWAVELLPFSIRV
NAIIVAEAWTPLYEKWINSFEDRDEKLKNITDKIPFENRMTSVDEIASMAVFLLSDKSSH
TTGQLIHVDGGYVHLDRALL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory