Comparing CA265_RS08130 FitnessBrowser__Pedo557:CA265_RS08130 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q47898 N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase; Aspartylglucosaminidase; AGA; Glycosylasparaginase; N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase; EC 3.5.1.26 from Elizabethkingia miricola (Chryseobacterium miricola) (see 5 papers)
66% identity, 93% coverage: 8:309/325 of query aligns to 37:324/340 of Q47898
Sites not aligning to the query:
1p4vA Crystal structure of the glycosylasparaginase precursor d151n mutant with glycine (see paper)
68% identity, 90% coverage: 19:309/325 of query aligns to 3:279/295 of 1p4vA
4r4yA Structural basis of a point mutation that causes the genetic disease aspartylglucosaminuria (see paper)
68% identity, 90% coverage: 19:309/325 of query aligns to 1:277/293 of 4r4yA
P20933 N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase; Aspartylglucosaminidase; Glycosylasparaginase; N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase; EC 3.5.1.26 from Homo sapiens (Human) (see 11 papers)
40% identity, 91% coverage: 20:314/325 of query aligns to 27:335/346 of P20933
Sites not aligning to the query:
2gl9B Crystal structure of glycosylasparaginase-substrate complex (see paper)
71% identity, 38% coverage: 186:309/325 of query aligns to 2:128/144 of 2gl9B
Sites not aligning to the query:
P30919 N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase; Aspartylglucosaminidase; AGA; Glycosylasparaginase; N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase; EC 3.5.1.26 from Rattus norvegicus (Rat) (see paper)
38% identity, 90% coverage: 20:312/325 of query aligns to 27:332/345 of P30919
Sites not aligning to the query:
Q7L266 Isoaspartyl peptidase/L-asparaginase; Asparaginase-like protein 1; Beta-aspartyl-peptidase; Isoaspartyl dipeptidase; L-asparagine amidohydrolase; EC 3.4.19.5; EC 3.5.1.1 from Homo sapiens (Human) (see 4 papers)
39% identity, 70% coverage: 38:264/325 of query aligns to 35:247/308 of Q7L266
P37595 Isoaspartyl peptidase; Beta-aspartyl-peptidase; EcAIII; Isoaspartyl dipeptidase; EC 3.4.19.5 from Escherichia coli (strain K12) (see 2 papers)
35% identity, 79% coverage: 39:294/325 of query aligns to 41:284/321 of P37595
4osxA Structure of uncleaved glycine-bound human l-asparaginase protein (see paper)
38% identity, 70% coverage: 38:264/325 of query aligns to 36:239/300 of 4osxA
Sites not aligning to the query:
4pvrA Crystal structure of partially-cleaved human l-asparaginase protein in complex with l-aspartate (see paper)
37% identity, 70% coverage: 38:264/325 of query aligns to 36:237/298 of 4pvrA
4o0hA Crystal structure of human l-asparaginase protein with covalently linked substrate l-asparagine (see paper)
36% identity, 70% coverage: 38:264/325 of query aligns to 36:234/295 of 4o0hA
4o48A Crystal structure of cleaved guinea pig l-asparaginase type iii in complex with l-aspartate (see paper)
36% identity, 71% coverage: 40:269/325 of query aligns to 38:242/298 of 4o48A
1apzB Human aspartylglucosaminidase complex with reaction product (see paper)
40% identity, 40% coverage: 185:314/325 of query aligns to 1:130/141 of 1apzB
Q9H6P5 Threonine aspartase 1; Taspase-1; EC 3.4.25.- from Homo sapiens (Human) (see 2 papers)
28% identity, 65% coverage: 37:246/325 of query aligns to 72:301/420 of Q9H6P5
1jn9A Structure of putative asparaginase encoded by escherichia coli ybik gene (see paper)
42% identity, 30% coverage: 39:136/325 of query aligns to 40:137/158 of 1jn9A
8c0iAAA Isoaspartyl peptidase subunit alpha (see paper)
42% identity, 30% coverage: 39:136/325 of query aligns to 40:137/156 of 8c0iAAA
Sites not aligning to the query:
2zalB Crystal structure of e. Coli isoaspartyl aminopeptidase/l-asparaginase in complex with l-aspartate (see paper)
39% identity, 34% coverage: 185:294/325 of query aligns to 1:106/135 of 2zalB
8c23DDD Isoaspartyl peptidase subunit beta (see paper)
38% identity, 34% coverage: 185:294/325 of query aligns to 1:106/135 of 8c23DDD
2gezB Crystal structure of potassium-independent plant asparaginase (see paper)
39% identity, 34% coverage: 185:295/325 of query aligns to 1:104/133 of 2gezB
2gezC Crystal structure of potassium-independent plant asparaginase (see paper)
46% identity, 27% coverage: 48:135/325 of query aligns to 48:135/166 of 2gezC
>CA265_RS08130 FitnessBrowser__Pedo557:CA265_RS08130
MDKSSIANVIPQEETAAKNFPIVISTWDFGIAANADAWKVLSTGGSALDAVEQGVWVPEA
DEHNQSVGYGGLPDRDGHVTLDACIMDELGNCGAVLALEHIKHPISVARKVMEKTPHVML
AGDGALQFALEQGFKKENLLTPASEKAWKEWLKTAKYAPVMNIENQLYQKAAPQKLPGNQ
YNHDTIGMLAIDAKGNISGACTTSGMAYKLHGRIGDSPIIGAGLYVDNEVGGATSTGVGE
EVVRNVGSFLVVELMRQGYTPEAACKEAVMRIIKKKPETAKNIQVGFLAINKKGEYGAYA
IQKGFSYAVCNAEKQDLLIKGKSYY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory