Comparing CA265_RS08345 FitnessBrowser__Pedo557:CA265_RS08345 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
7bywA Crystal structure of acidovorax avenae l-fucose mutarotase (l-fucose- bound form) (see paper)
26% identity, 85% coverage: 17:109/109 of query aligns to 14:107/108 of 7bywA
1x8dA Crystal structure of e. Coli yiil protein containing l-rhamnose (see paper)
31% identity, 72% coverage: 18:96/109 of query aligns to 16:92/104 of 1x8dA
P32156 L-rhamnose mutarotase; Rhamnose 1-epimerase; Type-3 mutarotase; EC 5.1.3.32 from Escherichia coli (strain K12) (see paper)
31% identity, 72% coverage: 18:96/109 of query aligns to 16:92/104 of P32156
>CA265_RS08345 FitnessBrowser__Pedo557:CA265_RS08345
MKRYCLTLDLVNDEKLIEEYKQYHQSVWPEIKESITSSGIEDMEIYLLGNRLFMIMEVNA
DFSFEEKGKADLTNPKVQEWENLMWKFQQALPGSKPGEKWMLMDQIFKL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory