Comparing CA265_RS08390 FitnessBrowser__Pedo557:CA265_RS08390 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4pfmA Shewanella benthica dhdps with lysine and pyruvate
25% identity, 71% coverage: 7:227/310 of query aligns to 5:220/295 of 4pfmA
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
24% identity, 87% coverage: 6:276/310 of query aligns to 3:267/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
24% identity, 87% coverage: 6:276/310 of query aligns to 3:267/291 of 3u8gA
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
24% identity, 87% coverage: 6:276/310 of query aligns to 3:267/291 of 3tdfA
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
24% identity, 87% coverage: 6:276/310 of query aligns to 3:267/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
24% identity, 87% coverage: 6:276/310 of query aligns to 3:267/291 of 3rk8A
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
24% identity, 87% coverage: 6:276/310 of query aligns to 3:267/291 of 3pueB
4ptnA Crystal structure of yage, a kdg aldolase protein in complex with magnesium cation coordinated l-glyceraldehyde (see paper)
26% identity, 73% coverage: 7:231/310 of query aligns to 5:228/298 of 4ptnA
4onvA Crystal structure of yage, a kdg aldolase protein in complex with 2- keto-3-deoxy gluconate
26% identity, 73% coverage: 7:231/310 of query aligns to 5:228/298 of 4onvA
4oe7D Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
26% identity, 73% coverage: 7:231/310 of query aligns to 5:228/298 of 4oe7D
4oe7B Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
26% identity, 73% coverage: 7:231/310 of query aligns to 5:228/298 of 4oe7B
4oe7A Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
26% identity, 73% coverage: 7:231/310 of query aligns to 5:228/298 of 4oe7A
3nevA Crystal structure of yage, a prophage protein from e. Coli k12 in complex with kdgal (see paper)
26% identity, 73% coverage: 7:231/310 of query aligns to 5:228/298 of 3nevA
Q5HG25 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Staphylococcus aureus (strain COL) (see paper)
25% identity, 70% coverage: 12:227/310 of query aligns to 12:222/295 of Q5HG25
3di1B Crystal structure of the staphylococcus aureus dihydrodipicolinate synthase-pyruvate complex (see paper)
25% identity, 70% coverage: 12:227/310 of query aligns to 12:222/291 of 3di1B
Sites not aligning to the query:
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
24% identity, 85% coverage: 6:270/310 of query aligns to 3:264/294 of 4i7wA
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
25% identity, 59% coverage: 6:189/310 of query aligns to 3:182/294 of Q8UGL3
3s8hA Structure of dihydrodipicolinate synthase complexed with 3- hydroxypropanoic acid(hpa)at 2.70 a resolution
22% identity, 85% coverage: 7:269/310 of query aligns to 4:261/292 of 3s8hA
3puoA Crystal structure of dihydrodipicolinate synthase from pseudomonas aeruginosa(psdhdps)complexed with l-lysine at 2.65a resolution (see paper)
22% identity, 85% coverage: 7:269/310 of query aligns to 4:261/292 of 3puoA
Sites not aligning to the query:
5c55A Crystal structure of the y138f mutant of c.Glutamicum n- acetylneuraminic acid lyase in complex with pyruvate
25% identity, 71% coverage: 7:226/310 of query aligns to 4:224/307 of 5c55A
>CA265_RS08390 FitnessBrowser__Pedo557:CA265_RS08390
MENSQKGFIPVMLTPFLSNGNIDYPALTQLTEIYLQAGSSGLFANCLSSEMFELSGKERI
QAIKHVIKVVDGAVPVVATGTFGGEISKQADFVKEVSDAGVEAVIAITSLLADESESDEV
FNDRVFDLLHQTDKIPLGFYECPVPYKRVLKPQQLADFVATDRVIYHKDTCLDLGQIKEK
LKLTAGKTFGLYDAYIVHAVESLKAGASGLSCIQGNYFPELIVWLCDHYNDETFKDEVQV
VQQFLIDNMDVMHNVYPVVSKYFLQKRGLNISTFTRRNVGSFTPSVVKEVETLFDDYTSL
RNNLNIKVFI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory