Comparing CA265_RS08625 FitnessBrowser__Pedo557:CA265_RS08625 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3qdkA Structural insight on mechanism and diverse substrate selection strategy of ribulokinase (see paper)
36% identity, 97% coverage: 5:553/566 of query aligns to 1:531/546 of 3qdkA
3l0qA The crystal structure of xlylulose kinase from yersinia pseudotuberculosis
27% identity, 97% coverage: 4:552/566 of query aligns to 1:536/541 of 3l0qA
3ge1A 2.7 angstrom crystal structure of glycerol kinase (glpk) from staphylococcus aureus in complex with adp and glycerol
31% identity, 24% coverage: 407:540/566 of query aligns to 350:484/499 of 3ge1A
Sites not aligning to the query:
Q5HGD2 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Staphylococcus aureus (strain COL)
31% identity, 24% coverage: 407:540/566 of query aligns to 349:483/498 of Q5HGD2
Sites not aligning to the query:
O34154 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus faecalis (strain ATCC 700802 / V583) (see 2 papers)
29% identity, 27% coverage: 405:558/566 of query aligns to 348:501/501 of O34154
Sites not aligning to the query:
3h3nX Glycerol kinase h232r with glycerol (see paper)
31% identity, 24% coverage: 405:540/566 of query aligns to 348:484/501 of 3h3nX
Sites not aligning to the query:
O34153 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus casseliflavus (Enterococcus flavescens) (see 3 papers)
31% identity, 24% coverage: 405:540/566 of query aligns to 349:485/506 of O34153
Sites not aligning to the query:
P18157 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Bacillus subtilis (strain 168) (see paper)
27% identity, 23% coverage: 407:537/566 of query aligns to 349:477/496 of P18157
Sites not aligning to the query:
2w40A Crystal structure of plasmodium falciparum glycerol kinase with bound glycerol (see paper)
20% identity, 26% coverage: 377:521/566 of query aligns to 320:467/501 of 2w40A
Sites not aligning to the query:
2w41B Crystal structure of plasmodium falciparum glycerol kinase with adp (see paper)
20% identity, 26% coverage: 377:521/566 of query aligns to 326:473/507 of 2w41B
Sites not aligning to the query:
1gldG Cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation (see paper)
25% identity, 22% coverage: 418:540/566 of query aligns to 351:472/489 of 1gldG
Sites not aligning to the query:
1glcG Cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation (see paper)
25% identity, 22% coverage: 418:540/566 of query aligns to 351:472/489 of 1glcG
Sites not aligning to the query:
1glbG Structure of the regulatory complex of escherichia coli iiiglc with glycerol kinase (see paper)
25% identity, 22% coverage: 418:540/566 of query aligns to 351:472/489 of 1glbG
Sites not aligning to the query:
1gllO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
25% identity, 22% coverage: 418:540/566 of query aligns to 356:477/494 of 1gllO
Sites not aligning to the query:
1gljO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
25% identity, 22% coverage: 418:540/566 of query aligns to 356:477/494 of 1gljO
Sites not aligning to the query:
1bwfO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
25% identity, 22% coverage: 418:540/566 of query aligns to 356:477/494 of 1bwfO
Sites not aligning to the query:
1bu6Y Crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation (see paper)
25% identity, 22% coverage: 418:540/566 of query aligns to 360:481/499 of 1bu6Y
Sites not aligning to the query:
P0A6F3 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Escherichia coli (strain K12) (see 10 papers)
25% identity, 22% coverage: 418:540/566 of query aligns to 362:483/502 of P0A6F3
Sites not aligning to the query:
1glfO Crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation (see paper)
25% identity, 22% coverage: 418:540/566 of query aligns to 360:481/498 of 1glfO
Sites not aligning to the query:
1bo5O Crystal structure of the complex between escherichia coli glycerol kinase and the allosteric regulator fructose 1,6-bisphosphate. (see paper)
25% identity, 22% coverage: 418:540/566 of query aligns to 360:481/498 of 1bo5O
Sites not aligning to the query:
>CA265_RS08625 FitnessBrowser__Pedo557:CA265_RS08625
MSTANYVIGVDYGTDSVRSVLVDTANGKEIASSVFLYPRWQKGLYCKPAVNQFRQHPLDY
IEGLTHTIKDCLAKAGGAEIAHLVKGISVDTTGSSPVAVDATGTPLALTKDFEENPNAMF
VLWKDHTSVKEAAEINEHATKFDTNYLKYVGGIYSSEWFWSKLLHILRVDLTIKKGAASW
VEHCDWIPFLLCGGNDISTMKRSRCAAGHKALWAEEFNGLPPEDFFSSLDPLLAGFRAKL
FTDTYTSDVSAGTLSEEWANKLGLNTDVVVGVGAFDAHMGAVGGQIEPYYLSKVMGTSTC
DILVAPNQDLHGKLINGICGQVNGSVIPGMAGLEAGQSAFGDVYAWFKNLISWPLNHLLT
ESEVIDEATATALKAELEGKIIANLSKQADALPNEDYAELAIDWLNGRRTPDANQELKGA
ITGLGLGTDAPRFFRALAAATCFGAKAIVDRFKEQGVPVKGIIGIGGVAKKSAYIMQMMA
DVLEMPIRIHRFEHTCALGAAMFAAVAAGIYPDIETAMAAMGTGFEKEYKPNIKKQKLYR
QHYQQYLGLGRYLEKYNKKDVKPYLS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory