Comparing CA265_RS10200 FitnessBrowser__Pedo557:CA265_RS10200 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2c4nA Nagd from e.Coli k-12 strain (see paper)
38% identity, 95% coverage: 3:250/260 of query aligns to 4:247/250 of 2c4nA
P0AF24 Ribonucleotide monophosphatase NagD; EC 3.1.3.5 from Escherichia coli (strain K12) (see paper)
38% identity, 95% coverage: 3:250/260 of query aligns to 4:247/250 of P0AF24
4o8cB Structure of the h170y mutant of thermostable p-nitrophenylphosphatase from bacillus stearothermophilus (see paper)
37% identity, 96% coverage: 3:252/260 of query aligns to 5:254/255 of 4o8cB
1ydfA Crystal structure of a had-like phosphatase from streptococcus pneumoniae
34% identity, 97% coverage: 1:252/260 of query aligns to 2:254/255 of 1ydfA
4jdpB Crystal structure of probable p-nitrophenyl phosphatase (pho2) (target efi-501307) from archaeoglobus fulgidus dsm 4304 with magnesium bound
31% identity, 96% coverage: 2:250/260 of query aligns to 7:261/265 of 4jdpB
3qgmA P-nitrophenyl phosphatase from archaeoglobus fulgidus
31% identity, 96% coverage: 2:250/260 of query aligns to 3:257/261 of 3qgmA
1zjjB Crystal structure of hypothetical protein ph1952 from pyrococcus horikoshii ot3
33% identity, 95% coverage: 4:250/260 of query aligns to 3:256/263 of 1zjjB
4bx2A Crystal structure of murine chronophin (pyridoxal phosphate phosphatase) in complex with beryllium trifluoride (see paper)
30% identity, 90% coverage: 3:236/260 of query aligns to 21:267/292 of 4bx2A
5aesA Crystal structure of murine chronophin (pyridoxal phosphate phosphatase) in complex with a pnp-derived inhibitor (see paper)
30% identity, 90% coverage: 3:236/260 of query aligns to 21:267/291 of 5aesA
P60487 Chronophin; Pyridoxal 5'-phosphate phosphatase; Pyridoxal phosphate phosphatase; PLP phosphatase; EC 3.1.3.16; EC 3.1.3.74 from Mus musculus (Mouse) (see 3 papers)
30% identity, 90% coverage: 3:236/260 of query aligns to 20:266/292 of P60487
5gynA Crystal structure of human pyridoxal 5'-phosphate phosphatase (chronophin) mutant - c221s
30% identity, 90% coverage: 3:236/260 of query aligns to 20:270/295 of 5gynA
2oycA Crystal structure of human pyridoxal phosphate phosphatase (see paper)
30% identity, 90% coverage: 3:236/260 of query aligns to 21:268/292 of 2oycA
2cftA Crystal structure of human pyridoxal 5'-phosphate phosphatase with its substrate
30% identity, 90% coverage: 3:236/260 of query aligns to 20:268/292 of 2cftA
Sites not aligning to the query:
Q96GD0 Chronophin; Pyridoxal phosphate phosphatase; PLP phosphatase; EC 3.1.3.16; EC 3.1.3.74 from Homo sapiens (Human) (see 2 papers)
29% identity, 90% coverage: 3:236/260 of query aligns to 20:270/296 of Q96GD0
4bkmA Crystal structure of the murine aum (phosphoglycolate phosphatase) capping domain as a fusion protein with the catalytic core domain of murine chronophin (pyridoxal phosphate phosphatase) (see paper)
29% identity, 90% coverage: 3:236/260 of query aligns to 21:280/304 of 4bkmA
P0DKC3 Phosphoglycolate phosphatase 1A, chloroplastic; EC 3.1.3.18 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 97% coverage: 5:255/260 of query aligns to 82:359/362 of P0DKC3
4i9gA Crystal structure of glycerol phosphate phosphatase rv1692 from mycobacterium tuberculosis in complex with magnesium (see paper)
30% identity, 87% coverage: 5:229/260 of query aligns to 12:235/329 of 4i9gA
O33194 D-glycerol 3-phosphate phosphatase; D,L-glycerol 3-phosphate phosphatase; G3P phosphatase from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
30% identity, 87% coverage: 5:229/260 of query aligns to 11:234/353 of O33194
4i9fA Crystal structure of glycerol phosphate phosphatase rv1692 from mycobacterium tuberculosis in complex with calcium (see paper)
30% identity, 87% coverage: 5:229/260 of query aligns to 10:233/336 of 4i9fA
Q8CHP8 Glycerol-3-phosphate phosphatase; G3PP; Aspartate-based ubiquitous Mg(2+)-dependent phosphatase; AUM; Phosphoglycolate phosphatase; PGP; EC 3.1.3.21; EC 3.1.3.48 from Mus musculus (Mouse) (see paper)
30% identity, 87% coverage: 5:229/260 of query aligns to 31:285/321 of Q8CHP8
>CA265_RS10200 FitnessBrowser__Pedo557:CA265_RS10200
MKQGLLIDMDGVIYSGEELIFGADKFIKNLIDEDIPFAFMTNNSQRTALEVVRKLKGLGI
KVEESHVYTSAMATGKFLSDQSPAGTAYVLGEGGLLSSLHDHGITLVNTDPEFVVLGEGR
NFTLEMVQRAVDMILAGAKFITTNRDPSPKKPGWNNLGIAATTAMIEEATGRKAFVTGKP
SPVMMRSARKFLGLETSETTVIGDTMETDIQGGVQMGYKTILVLSGISSKDTLGHYAFKP
DMIASSVDEIKFPLAWWEDK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory