SitesBLAST
Comparing CA265_RS12040 FitnessBrowser__Pedo557:CA265_RS12040 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5a05A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with maltotriose (see paper)
43% identity, 88% coverage: 46:383/386 of query aligns to 1:335/335 of 5a05A
- active site: K100 (= K145), Y185 (= Y230)
- binding beta-D-glucopyranose: K100 (= K145), F159 (≠ Q204), D181 (= D226), Y185 (= Y230)
- binding alpha-D-glucopyranose: P259 (≠ R305), S262 (≠ A308)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G54), L10 (= L55), G11 (= G56), Y12 (≠ H57), Y13 (≠ L58), S35 (= S80), G36 (= G81), T37 (≠ D82), K40 (= K85), Y58 (= Y103), I76 (= I121), T77 (≠ L122), P78 (= P123), N79 (= N124), L81 (≠ M126), H82 (= H127), E99 (= E144), K100 (= K145), R128 (= R173), W167 (= W212), R168 (= R213), Y185 (= Y230), Y263 (= Y309)
5a04A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glucose (see paper)
43% identity, 88% coverage: 46:383/386 of query aligns to 1:335/335 of 5a04A
- active site: K100 (= K145), Y185 (= Y230)
- binding beta-D-glucopyranose: K100 (= K145), F159 (≠ Q204), R168 (= R213), D181 (= D226), Y185 (= Y230)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L10 (= L55), G11 (= G56), Y12 (≠ H57), Y13 (≠ L58), S35 (= S80), G36 (= G81), T37 (≠ D82), K40 (= K85), Y58 (= Y103), I76 (= I121), T77 (≠ L122), P78 (= P123), N79 (= N124), L81 (≠ M126), H82 (= H127), E99 (= E144), K100 (= K145), R128 (= R173), W167 (= W212), R168 (= R213), Y185 (= Y230), Y263 (= Y309)
5a03E Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
43% identity, 88% coverage: 46:383/386 of query aligns to 1:335/335 of 5a03E
- active site: K100 (= K145), Y185 (= Y230)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G54), L10 (= L55), G11 (= G56), Y12 (≠ H57), Y13 (≠ L58), S35 (= S80), G36 (= G81), T37 (≠ D82), K40 (= K85), Y58 (= Y103), I76 (= I121), T77 (≠ L122), P78 (= P123), N79 (= N124), H82 (= H127), E99 (= E144), K100 (= K145), R128 (= R173), W167 (= W212), R168 (= R213), Y185 (= Y230), Y263 (= Y309)
- binding beta-D-xylopyranose: K100 (= K145), F159 (≠ Q204), R168 (= R213), D181 (= D226), Y185 (= Y230), E205 (≠ Q250), T207 (≠ S252), R209 (≠ P254)
- binding alpha-D-xylopyranose: H134 (= H179), M268 (≠ L314), R279 (≠ E326), E280 (= E327)
5a02A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glycerol (see paper)
43% identity, 88% coverage: 46:383/386 of query aligns to 1:335/335 of 5a02A
- active site: K100 (= K145), Y185 (= Y230)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L10 (= L55), G11 (= G56), Y12 (≠ H57), Y13 (≠ L58), S35 (= S80), G36 (= G81), T37 (≠ D82), K40 (= K85), Y58 (= Y103), I76 (= I121), T77 (≠ L122), P78 (= P123), L81 (≠ M126), H82 (= H127), E99 (= E144), K100 (= K145), R128 (= R173), W167 (= W212), R168 (= R213), Y185 (= Y230), Y263 (= Y309)
5a06A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with sorbitol (see paper)
43% identity, 88% coverage: 45:383/386 of query aligns to 1:336/336 of 5a06A
- active site: K101 (= K145), Y186 (= Y230)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L11 (= L55), G12 (= G56), Y13 (≠ H57), Y14 (≠ L58), S36 (= S80), G37 (= G81), T38 (≠ D82), K41 (= K85), Y59 (= Y103), I77 (= I121), T78 (≠ L122), P79 (= P123), N80 (= N124), L82 (≠ M126), H83 (= H127), E100 (= E144), K101 (= K145), R129 (= R173), W168 (= W212), R169 (= R213), Y186 (= Y230), Y264 (= Y309)
- binding sorbitol: R2 (≠ Q46), D72 (≠ S116), H96 (= H140), K101 (= K145), R122 (≠ V166), R122 (≠ V166), L124 (= L168), F160 (≠ Q204), R169 (= R213), D182 (= D226), Y186 (= Y230), K287 (vs. gap), H296 (= H343), E299 (= E346), E306 (≠ D353), G310 (≠ P357), G311 (≠ A358)
5a03C Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
43% identity, 88% coverage: 45:383/386 of query aligns to 1:336/336 of 5a03C
- active site: K101 (= K145), Y186 (= Y230)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G10 (= G54), L11 (= L55), G12 (= G56), Y13 (≠ H57), Y14 (≠ L58), S36 (= S80), G37 (= G81), T38 (≠ D82), K41 (= K85), Y59 (= Y103), I77 (= I121), T78 (≠ L122), P79 (= P123), N80 (= N124), L82 (≠ M126), H83 (= H127), E100 (= E144), K101 (= K145), R129 (= R173), W168 (= W212), R169 (= R213), Y186 (= Y230), Y264 (= Y309)
- binding beta-D-xylopyranose: K101 (= K145), F160 (≠ Q204), R169 (= R213), D182 (= D226), Y186 (= Y230)
1h6dA Oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol (see paper)
40% identity, 92% coverage: 29:382/386 of query aligns to 15:372/383 of 1h6dA
- active site: K131 (= K145), Y219 (= Y230)
- binding glycerol: K131 (= K145), R202 (= R213), D215 (= D226), Y219 (= Y230)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A17 (= A31), G18 (≠ D32), R19 (≠ K33), G40 (= G54), L41 (= L55), G42 (= G56), K43 (≠ H57), Y44 (≠ L58), S66 (= S80), G67 (= G81), K71 (= K85), Y89 (= Y103), I107 (= I121), L108 (= L122), P109 (= P123), N110 (= N124), H113 (= H127), E130 (= E144), K131 (= K145), R159 (= R173), A198 (vs. gap), W201 (= W212), R202 (= R213), Y219 (= Y230), Y298 (= Y309)
1rydA Crystal structure of glucose-fructose oxidoreductase from zymomonas mobilis
40% identity, 92% coverage: 29:382/386 of query aligns to 13:370/381 of 1rydA
- active site: K129 (= K145), Y217 (= Y230)
- binding alpha-D-glucopyranose: Y236 (= Y249), I254 (≠ S267), Q256 (= Q269)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L39 (= L55), G40 (= G56), K41 (≠ H57), Y42 (≠ L58), S64 (= S80), G65 (= G81), K69 (= K85), Y87 (= Y103), L106 (= L122), P107 (= P123), N108 (= N124), L110 (≠ M126), H111 (= H127), E128 (= E144), K129 (= K145), R157 (= R173), A196 (vs. gap), W199 (= W212), R200 (= R213), Y217 (= Y230), Y296 (= Y309)
1evjA Crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d (see paper)
40% identity, 87% coverage: 46:382/386 of query aligns to 1:329/340 of 1evjA
- active site: K100 (= K145), Y188 (= Y230)
- binding nicotinamide-adenine-dinucleotide: G9 (= G54), L10 (= L55), G11 (= G56), K12 (≠ H57), Y13 (≠ L58), D35 (≠ S80), L77 (= L122), P78 (= P123), N79 (= N124), H82 (= H127), E99 (= E144), K100 (= K145), R128 (= R173), W170 (= W212), R171 (= R213), Y188 (= Y230), Y267 (= Y309)
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
25% identity, 87% coverage: 50:383/386 of query aligns to 3:328/332 of 2glxA
- active site: K93 (= K145), H179 (≠ Y230)
- binding acetate ion: K93 (= K145), H179 (≠ Y230)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G54), A8 (≠ L55), S9 (≠ G56), T10 (≠ H57), I11 (≠ L58), S32 (= S80), T33 (≠ G81), R37 (≠ K85), S69 (≠ I121), T70 (≠ L122), N72 (= N124), H75 (= H127), E92 (= E144), K93 (= K145), H121 (≠ R173), W161 (= W212), R162 (= R213), Y282 (≠ F337)
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
25% identity, 87% coverage: 50:383/386 of query aligns to 4:329/333 of Q2I8V6
- ASTI 9:12 (≠ LGHL 55:58) binding
- S10 (≠ G56) mutation to G: Almost no effect.
- A13 (= A59) mutation to G: Can use NAD as cosubstrate as well as NADP.
- S33 (= S80) mutation to D: No activity.
- ST 33:34 (≠ SG 80:81) binding
- R38 (≠ K85) binding
- TTNELH 71:76 (≠ LPNSMH 122:127) binding
- EK 93:94 (= EK 144:145) binding
- K94 (= K145) mutation to G: Less than 1% remaining activity.
- N120 (≠ A171) binding
- WR 162:163 (= WR 212:213) binding
- D176 (= D226) mutation to A: Less than 1% remaining activity.
- H180 (≠ Y230) mutation to A: Less than 2% remaining activity.
- G206 (≠ D256) mutation to I: No effect.
- Y283 (≠ F337) binding
4koaA Crystal structure analysis of 1,5-anhydro-d-fructose reductase from sinorhizobium meliloti (see paper)
26% identity, 87% coverage: 48:383/386 of query aligns to 2:329/333 of 4koaA
- active site: K94 (= K145), H180 (≠ Y230)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G54), A9 (≠ L55), S10 (≠ G56), T11 (≠ H57), I12 (≠ L58), S33 (= S80), S34 (≠ G81), R38 (≠ K85), T71 (≠ L122), N73 (= N124), H76 (= H127), K94 (= K145), Q160 (vs. gap)
7xr9A Crystal structure of dgpa with glucose (see paper)
28% identity, 75% coverage: 87:377/386 of query aligns to 36:339/344 of 7xr9A
- binding beta-D-glucopyranose: K91 (= K145), R150 (≠ Q204), W157 (≠ H211), F160 (≠ H214), D173 (= D226), H177 (≠ Y230)
- binding nicotinamide-adenine-dinucleotide: D51 (≠ S102), Y52 (= Y103), C67 (≠ I121), T68 (≠ L122), P69 (= P123), H73 (= H127), E90 (= E144), K91 (= K145), P92 (= P146), Q119 (≠ R173), V159 (≠ R213), F160 (≠ H214), Q166 (vs. gap)
Sites not aligning to the query:
7xreC Crystal structure of dgpa
29% identity, 70% coverage: 106:377/386 of query aligns to 62:358/363 of 7xreC
- binding nicotinamide-adenine-dinucleotide: T78 (≠ L122), P79 (= P123), N80 (= N124), H83 (= H127), E100 (= E144), K101 (= K145), P102 (= P146), F170 (≠ H214), Q176 (vs. gap), H187 (≠ Y230), Y313 (≠ F337), F314 (≠ G338)
Sites not aligning to the query:
B3TMR8 dTDP-3,4-didehydro-2,6-dideoxy-alpha-D-glucose 3-reductase; 3-ketoreductase; NADPH-dependent C3-ketoreductase; EC 1.1.1.384 from Actinomadura kijaniata (see paper)
22% identity, 85% coverage: 47:376/386 of query aligns to 11:327/332 of B3TMR8
- 17:23 (vs. 55:61, 14% identical) binding
- SR 42:43 (≠ SG 80:81) binding
- Y63 (≠ F106) binding
- L79 (= L122) binding
- H84 (= H127) binding
- K102 (= K145) active site, Proton donor; mutation K->A,M,Q: Loss of reductase activity.; mutation to E: Retains some activity, but the catalytic efficiency is strongly reduced.
- R170 (= R213) binding
- D182 (= D226) binding
- Y186 (= Y230) mutation to F: Same affinity for dTDP-glucose and NADPH compared to the wild-type. Small reduction of the catalytic efficiency resulting from the conformational flexibility of the nicotinamide ring.
3rc1A Crystal structure of kijd10, a 3-ketoreductase from actinomadura kijaniata incomplex with NADP and tdp-benzene (see paper)
22% identity, 85% coverage: 47:376/386 of query aligns to 4:320/325 of 3rc1A
- active site: K95 (= K145), Y179 (= Y230)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: C10 (≠ L55), A11 (≠ G56), D12 (≠ H57), I13 (≠ L58), S35 (= S80), R36 (≠ G81), Y56 (≠ F106), P71 (≠ I121), L72 (= L122), P73 (= P123), H77 (= H127), E94 (= E144), K95 (= K145), I162 (≠ W212), R163 (= R213), V168 (≠ L218), D175 (= D226), Y179 (= Y230)
- binding phosphate ion: H278 (≠ P334), K283 (≠ A339)
- binding 5'-O-[(S)-hydroxy{[(S)-hydroxy(phenoxy)phosphoryl]oxy}phosphoryl]thymidine: R16 (≠ E61), R17 (≠ E62), F152 (≠ N202), I154 (≠ Q204), P155 (≠ S205), Y233 (≠ C280), T253 (≠ A308)
3ceaA Crystal structure of myo-inositol 2-dehydrogenase (np_786804.1) from lactobacillus plantarum at 2.40 a resolution
21% identity, 86% coverage: 51:383/386 of query aligns to 8:340/342 of 3ceaA
- active site: K98 (= K145), H185 (≠ Y230)
- binding nicotinamide-adenine-dinucleotide: G11 (= G54), G13 (= G56), R14 (≠ H57), L15 (= L58), L38 (≠ G81), Q42 (≠ K85), V74 (≠ I121), A75 (≠ L122), P76 (= P123), T77 (≠ N124), F79 (≠ M126), H80 (= H127), M83 (≠ F130), E97 (= E144), K98 (= K145), M127 (= M174), F169 (≠ H214), H185 (≠ Y230), F286 (≠ E322)
3e18A Crystal structure of NAD-binding protein from listeria innocua
22% identity, 72% coverage: 103:381/386 of query aligns to 52:346/348 of 3e18A
- active site: K94 (= K145), H178 (≠ Y230)
- binding nicotinamide-adenine-dinucleotide: A70 (≠ I121), T71 (≠ L122), P72 (= P123), N73 (= N124), H76 (= H127), E93 (= E144), K94 (= K145), N122 (≠ R173), W161 (= W212), R162 (= R213), H178 (≠ Y230)
Sites not aligning to the query:
3q2kC Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
23% identity, 87% coverage: 45:378/386 of query aligns to 5:339/347 of 3q2kC
- active site: K100 (= K145), H188 (≠ I229)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R17 (≠ H57), K100 (= K145), W159 (vs. gap), T160 (vs. gap), R161 (vs. gap), Y165 (≠ S206), N184 (≠ P225), Q185 (≠ D226), H188 (≠ I229), Q243 (≠ I286), N244 (≠ R287)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G16 (= G56), R17 (≠ H57), I18 (≠ L58), D40 (≠ S80), T41 (≠ G81), A76 (≠ I121), T77 (≠ L122), S79 (≠ N124), H82 (= H127), Q85 (≠ F130), E99 (= E144), K100 (= K145), Q128 (≠ R173), W171 (= W212), R172 (= R213)
7x2yA Crystal structure of cis-4,5-dihydrodiol phthalate dehydrogenase in complex with NAD+ and 3-hydroxybenzoate (see paper)
30% identity, 46% coverage: 103:279/386 of query aligns to 53:222/342 of 7x2yA
- binding 3-hydroxybenzoic acid: H122 (≠ Y172), Q173 (≠ I227), H176 (≠ Y230)
- binding nicotinamide-adenine-dinucleotide: A71 (≠ I121), S72 (≠ L122), P73 (= P123), F76 (≠ M126), Q80 (≠ F130), E94 (= E144), K95 (= K145), P96 (= P146), R161 (≠ K215), P163 (≠ K217), E164 (≠ L218)
Sites not aligning to the query:
Query Sequence
>CA265_RS12040 FitnessBrowser__Pedo557:CA265_RS12040
MVVIKRQIPTLMDKAKNADKPVKLEKWKSSADKSTPPPPAPIPENQRIGYAVVGLGHLAL
EEVIPALSGCKFSRLAALVSGDDKKMEKVALQYGVSPGSCYSYERFDEIKNNTDVSVIYI
ILPNSMHMEFTVRGARAGKHILCEKPMANSSAECRKMIAACNKAKVKLMIAYRMQFQPHT
LKLKEMVSNERFGRVRYIETVNGQSSANPDHWRHKAKLAGGGVLPDIGIYCLNTTRFILG
KEPIEVFAYQYSTPKDPLFKDTEELISWQMKFDEGLIASCMAHYKIREVKTMRIHAERGW
MFMDRAFAYKGQQLKTSRAEGEEEIEETISVPEPNQFGAEMDHFSECILRKKDPKTPAEE
GLRDHVIMEAIYKSAKTGKPVKIIKT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory